Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSUW23_RS12360 | Genome accession | NC_014479 |
| Coordinates | 2409189..2409362 (+) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus spizizenii str. W23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2404189..2414362
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSUW23_RS12345 (BSUW23_12165) | gcvT | 2404984..2406072 (-) | 1089 | WP_003226353.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSUW23_RS12350 (BSUW23_12170) | - | 2406515..2408188 (+) | 1674 | WP_003226350.1 | DEAD/DEAH box helicase | - |
| BSUW23_RS12355 (BSUW23_12175) | - | 2408209..2409003 (+) | 795 | WP_003226349.1 | YqhG family protein | - |
| BSUW23_RS12360 (BSUW23_12180) | sinI | 2409189..2409362 (+) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| BSUW23_RS12365 (BSUW23_12185) | sinR | 2409396..2409731 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSUW23_RS12370 (BSUW23_12190) | tasA | 2409825..2410610 (-) | 786 | WP_003226340.1 | biofilm matrix protein TasA | - |
| BSUW23_RS12375 (BSUW23_12195) | sipW | 2410674..2411246 (-) | 573 | WP_003226338.1 | signal peptidase I SipW | - |
| BSUW23_RS12380 (BSUW23_12200) | tapA | 2411230..2411991 (-) | 762 | WP_003226335.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSUW23_RS12385 (BSUW23_12205) | - | 2412260..2412586 (+) | 327 | WP_079996407.1 | YqzG/YhdC family protein | - |
| BSUW23_RS12390 (BSUW23_12210) | - | 2412628..2412807 (-) | 180 | WP_003226330.1 | YqzE family protein | - |
| BSUW23_RS12395 (BSUW23_12215) | comGG | 2412879..2413253 (-) | 375 | WP_003226328.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BSUW23_RS12400 (BSUW23_12220) | comGF | 2413254..2413637 (-) | 384 | WP_032727308.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BSUW23_RS12405 (BSUW23_12225) | comGE | 2413663..2414010 (-) | 348 | WP_003226323.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=38193 BSUW23_RS12360 WP_003226347.1 2409189..2409362(+) (sinI) [Bacillus spizizenii str. W23]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=38193 BSUW23_RS12360 WP_003226347.1 2409189..2409362(+) (sinI) [Bacillus spizizenii str. W23]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |