Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   BSUW23_RS12400 Genome accession   NC_014479
Coordinates   2413254..2413637 (-) Length   127 a.a.
NCBI ID   WP_032727308.1    Uniprot ID   -
Organism   Bacillus spizizenii str. W23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2408254..2418637
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUW23_RS12360 (BSUW23_12180) sinI 2409189..2409362 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  BSUW23_RS12365 (BSUW23_12185) sinR 2409396..2409731 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSUW23_RS12370 (BSUW23_12190) tasA 2409825..2410610 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  BSUW23_RS12375 (BSUW23_12195) sipW 2410674..2411246 (-) 573 WP_003226338.1 signal peptidase I SipW -
  BSUW23_RS12380 (BSUW23_12200) tapA 2411230..2411991 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  BSUW23_RS12385 (BSUW23_12205) - 2412260..2412586 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  BSUW23_RS12390 (BSUW23_12210) - 2412628..2412807 (-) 180 WP_003226330.1 YqzE family protein -
  BSUW23_RS12395 (BSUW23_12215) comGG 2412879..2413253 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSUW23_RS12400 (BSUW23_12220) comGF 2413254..2413637 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  BSUW23_RS12405 (BSUW23_12225) comGE 2413663..2414010 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSUW23_RS12410 (BSUW23_12230) comGD 2413994..2414425 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSUW23_RS12415 (BSUW23_12235) comGC 2414415..2414711 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  BSUW23_RS12420 (BSUW23_12240) comGB 2414725..2415762 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  BSUW23_RS12425 (BSUW23_12245) comGA 2415749..2416819 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  BSUW23_RS12430 (BSUW23_12250) - 2417032..2417442 (-) 411 WP_032727412.1 CBS domain-containing protein -
  BSUW23_RS12435 (BSUW23_12255) - 2417505..2418458 (-) 954 WP_003226308.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14414.59 Da        Isoelectric Point: 6.9668

>NTDB_id=38196 BSUW23_RS12400 WP_032727308.1 2413254..2413637(-) (comGF) [Bacillus spizizenii str. W23]
MLISGSLAMIFHLFLSRQQEYEGFTQQEWLISMEQMMNECKQSHAVKTAEHGSVLICTNPSGQDIRFEIYHSMIRKRVDG
KGHVPILDNITAMRADIENGVVLLKIKSENQKVYQTAFSVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=38196 BSUW23_RS12400 WP_032727308.1 2413254..2413637(-) (comGF) [Bacillus spizizenii str. W23]
TTGCTCATATCAGGATCGTTAGCTATGATCTTCCATTTGTTTTTGTCACGGCAGCAGGAATATGAGGGTTTCACACAGCA
AGAATGGTTGATTTCGATGGAACAGATGATGAACGAATGCAAGCAGTCACACGCAGTCAAGACAGCCGAACATGGGAGCG
TGTTGATCTGTACCAATCCTTCTGGGCAAGATATACGTTTTGAAATCTATCATTCCATGATAAGAAAAAGGGTAGATGGC
AAAGGGCATGTTCCGATTCTAGATAATATTACAGCCATGAGAGCCGATATTGAAAATGGTGTTGTTTTACTGAAAATTAA
GAGTGAGAACCAAAAAGTGTATCAAACTGCTTTTTCGGTTTATTCGTATTTAGGAGGAGGGTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

88.189

100

0.882

Multiple sequence alignment