Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   FGL72_RS02555 Genome accession   NZ_CP042410
Coordinates   525385..525834 (+) Length   149 a.a.
NCBI ID   WP_040177056.1    Uniprot ID   -
Organism   Leuconostoc citreum strain CBA3621     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 516460..561260 525385..525834 within 0


Gene organization within MGE regions


Location: 516460..561260
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL72_RS02475 (FGL72_02475) - 516460..517638 (-) 1179 WP_085699756.1 tyrosine-type recombinase/integrase -
  FGL72_RS02480 (FGL72_02480) - 518087..518536 (-) 450 WP_146992517.1 hypothetical protein -
  FGL72_RS02485 (FGL72_02485) - 518606..519307 (-) 702 WP_146992518.1 hypothetical protein -
  FGL72_RS02490 (FGL72_02490) - 519357..519776 (-) 420 WP_146992520.1 ImmA/IrrE family metallo-endopeptidase -
  FGL72_RS02495 (FGL72_02495) - 519773..520123 (-) 351 WP_146992523.1 helix-turn-helix domain-containing protein -
  FGL72_RS02500 (FGL72_02500) - 520376..520579 (+) 204 WP_146992525.1 helix-turn-helix domain-containing protein -
  FGL72_RS02505 (FGL72_02505) - 520590..521381 (+) 792 WP_146992527.1 phage antirepressor KilAC domain-containing protein -
  FGL72_RS02510 (FGL72_02510) - 521494..521706 (-) 213 WP_040177065.1 heavy-metal-associated domain-containing protein -
  FGL72_RS02515 (FGL72_02515) - 521809..522078 (+) 270 WP_004900864.1 hypothetical protein -
  FGL72_RS02520 (FGL72_02520) - 522156..522353 (+) 198 WP_040177063.1 hypothetical protein -
  FGL72_RS02525 (FGL72_02525) - 522346..522543 (+) 198 WP_040177061.1 helix-turn-helix domain-containing protein -
  FGL72_RS02530 (FGL72_02530) - 522533..522715 (+) 183 WP_040177059.1 hypothetical protein -
  FGL72_RS02535 (FGL72_02535) - 522719..523519 (+) 801 WP_052437264.1 conserved phage C-terminal domain-containing protein -
  FGL72_RS02540 (FGL72_02540) - 523523..523789 (+) 267 WP_040177058.1 hypothetical protein -
  FGL72_RS02545 (FGL72_02545) - 523867..524778 (+) 912 WP_052437263.1 DUF1351 domain-containing protein -
  FGL72_RS02550 (FGL72_02550) - 524775..525398 (+) 624 WP_040177057.1 ERF family protein -
  FGL72_RS02555 (FGL72_02555) ssb 525385..525834 (+) 450 WP_040177056.1 single-stranded DNA-binding protein Machinery gene
  FGL72_RS02560 (FGL72_02560) - 525846..526529 (+) 684 WP_040177054.1 putative HNHc nuclease -
  FGL72_RS02565 (FGL72_02565) - 526538..526942 (+) 405 WP_004903903.1 hypothetical protein -
  FGL72_RS02570 (FGL72_02570) - 527369..527779 (+) 411 WP_004903898.1 DUF722 domain-containing protein -
  FGL72_RS02575 (FGL72_02575) - 528493..528684 (+) 192 WP_146992529.1 hypothetical protein -
  FGL72_RS02580 (FGL72_02580) - 528668..529066 (+) 399 WP_146992531.1 DUF2335 domain-containing protein -
  FGL72_RS02590 (FGL72_02590) - 529375..529827 (+) 453 WP_004907787.1 cupin domain-containing protein -
  FGL72_RS02595 (FGL72_02595) - 529966..530165 (+) 200 Protein_511 hypothetical protein -
  FGL72_RS02600 (FGL72_02600) - 530226..530759 (+) 534 WP_146992533.1 HNH endonuclease -
  FGL72_RS02605 (FGL72_02605) - 530759..531073 (+) 315 WP_004907778.1 hypothetical protein -
  FGL72_RS02610 (FGL72_02610) - 531326..531892 (+) 567 WP_139988227.1 phage terminase small subunit P27 family -
  FGL72_RS02615 (FGL72_02615) - 531879..533759 (+) 1881 WP_139988226.1 terminase TerL endonuclease subunit -
  FGL72_RS09940 (FGL72_02620) - 533759..533947 (+) 189 WP_420870279.1 DUF1056 family protein -
  FGL72_RS02625 (FGL72_02625) - 533952..535103 (+) 1152 WP_146992535.1 phage portal protein -
  FGL72_RS02630 (FGL72_02630) - 535100..535789 (+) 690 WP_139988224.1 head maturation protease, ClpP-related -
  FGL72_RS02635 (FGL72_02635) - 535800..536963 (+) 1164 WP_139988223.1 phage major capsid protein -
  FGL72_RS02640 (FGL72_02640) - 536974..537300 (+) 327 WP_012305284.1 head-tail connector protein -
  FGL72_RS02645 (FGL72_02645) - 537293..537664 (+) 372 WP_139988222.1 phage head closure protein -
  FGL72_RS02650 (FGL72_02650) - 537654..538070 (+) 417 WP_139988221.1 HK97-gp10 family putative phage morphogenesis protein -
  FGL72_RS02655 (FGL72_02655) - 538067..538441 (+) 375 WP_139988220.1 DUF806 family protein -
  FGL72_RS02660 (FGL72_02660) - 538445..539095 (+) 651 WP_085699938.1 phage tail protein -
  FGL72_RS02665 (FGL72_02665) - 539196..539624 (+) 429 WP_139988219.1 phage tail tube assembly chaperone -
  FGL72_RS02675 (FGL72_02675) - 539834..545647 (+) 5814 WP_146992538.1 phage tail tape measure protein -
  FGL72_RS02680 (FGL72_02680) - 545710..548067 (+) 2358 WP_139988217.1 distal tail protein Dit -
  FGL72_RS02685 (FGL72_02685) - 548118..553700 (+) 5583 WP_146992540.1 hypothetical protein -
  FGL72_RS02690 (FGL72_02690) - 553697..553906 (+) 210 WP_146992543.1 hypothetical protein -
  FGL72_RS02695 (FGL72_02695) - 553969..554202 (+) 234 WP_139988214.1 hypothetical protein -
  FGL72_RS09705 - 554202..554342 (+) 141 WP_180896877.1 hypothetical protein -
  FGL72_RS02700 (FGL72_02700) - 554342..554800 (+) 459 WP_243130152.1 hypothetical protein -
  FGL72_RS02705 (FGL72_02705) - 554800..555222 (+) 423 WP_139988212.1 phage holin, LLH family -
  FGL72_RS02710 (FGL72_02710) - 555233..556192 (+) 960 WP_146992545.1 lytic exoenzyme target recognition domain-containing protein -
  FGL72_RS02715 (FGL72_02715) - 556258..556806 (+) 549 WP_146992547.1 hypothetical protein -
  FGL72_RS02720 (FGL72_02720) - 557103..557501 (+) 399 WP_040177025.1 fluoride efflux transporter FluC -
  FGL72_RS02725 (FGL72_02725) - 557502..557846 (+) 345 WP_004903627.1 fluoride efflux transporter FluC -
  FGL72_RS02730 (FGL72_02730) - 558826..559086 (-) 261 WP_004903626.1 SemiSWEET family transporter -
  FGL72_RS02735 (FGL72_02735) rarD 559165..560058 (-) 894 WP_004904705.1 EamA family transporter RarD -
  FGL72_RS02740 (FGL72_02740) - 560238..561260 (+) 1023 WP_004903622.1 SGNH/GDSL hydrolase family protein -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16508.17 Da        Isoelectric Point: 5.2048

>NTDB_id=377744 FGL72_RS02555 WP_040177056.1 525385..525834(+) (ssb) [Leuconostoc citreum strain CBA3621]
MNQVNLIGRLSKDIEVRYTQSGKAVGSGSIAVNRRFRSANGERQADFINFVIWDKAAENLANFTHKGSQVRLGGEWQTRN
YENNNGQKVYVNELVVNAFDLLDPKAATQTQSNLDNVDPFAGQNTKQSPNPFAASGKTEIDISDDDLPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=377744 FGL72_RS02555 WP_040177056.1 525385..525834(+) (ssb) [Leuconostoc citreum strain CBA3621]
ATGAACCAAGTTAATTTAATCGGTCGTTTGTCAAAAGACATTGAAGTTAGATATACACAATCAGGAAAAGCGGTTGGAAG
TGGCTCAATCGCAGTTAATCGCCGCTTTAGAAGTGCTAATGGTGAGCGCCAAGCCGACTTTATCAACTTTGTTATCTGGG
ACAAGGCGGCTGAAAACTTAGCTAATTTCACACACAAAGGCTCACAGGTTAGGCTAGGTGGCGAGTGGCAAACACGCAAC
TATGAAAACAACAATGGCCAAAAAGTCTATGTGAATGAGTTGGTAGTCAATGCCTTTGATTTATTAGATCCAAAAGCTGC
GACACAGACACAAAGTAACTTGGATAACGTGGATCCGTTCGCCGGACAGAACACAAAGCAGTCACCTAATCCTTTTGCAG
CATCAGGAAAAACAGAAATTGACATTTCAGATGATGACTTGCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.577

  ssbA Bacillus subtilis subsp. subtilis str. 168

44.767

100

0.517

  ssbB Streptococcus sobrinus strain NIDR 6715-7

39.865

99.329

0.396


Multiple sequence alignment