Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPB8_RS07500 Genome accession   NC_014256
Coordinates   1554458..1554571 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori B8     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1549458..1559571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPB8_RS07480 (HPB8_1582) - 1550124..1551536 (-) 1413 WP_001861341.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPB8_RS07485 (HPB8_1583) comB10 1551606..1552742 (-) 1137 WP_001045869.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPB8_RS07490 (HPB8_1584) comB9 1552735..1553718 (-) 984 WP_001861340.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPB8_RS07495 (HPB8_1585) comB8 1553718..1554461 (-) 744 WP_000660520.1 type IV secretion system protein Machinery gene
  HPB8_RS07500 (HPB8_1586) comB7 1554458..1554571 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPB8_RS07505 (HPB8_1587) comB6 1554587..1555642 (-) 1056 WP_000786677.1 P-type conjugative transfer protein TrbL Machinery gene
  HPB8_RS07510 (HPB8_1588) - 1555650..1556645 (-) 996 WP_000468428.1 PDZ domain-containing protein -
  HPB8_RS07515 (HPB8_1589) - 1556645..1556947 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPB8_RS07520 (HPB8_1590) panD 1556950..1557303 (-) 354 WP_000142236.1 aspartate 1-decarboxylase -
  HPB8_RS07525 (HPB8_1591) - 1557293..1559518 (-) 2226 WP_001051506.1 AAA family ATPase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=37663 HPB8_RS07500 WP_001217873.1 1554458..1554571(-) (comB7) [Helicobacter pylori B8]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=37663 HPB8_RS07500 WP_001217873.1 1554458..1554571(-) (comB7) [Helicobacter pylori B8]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment