Detailed information
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | FPS98_RS07060 | Genome accession | NZ_CP042161 |
| Coordinates | 1481646..1482074 (-) | Length | 142 a.a. |
| NCBI ID | WP_144614751.1 | Uniprot ID | A0A517I4F4 |
| Organism | Brevibacillus brevis strain HK544 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1451448..1481599 | 1481646..1482074 | flank | 47 |
Gene organization within MGE regions
Location: 1451448..1482074
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FPS98_RS06875 (FPS98_06875) | - | 1451448..1452698 (+) | 1251 | WP_144614705.1 | hypothetical protein | - |
| FPS98_RS06880 (FPS98_06880) | - | 1452768..1453076 (+) | 309 | WP_144614707.1 | hypothetical protein | - |
| FPS98_RS06890 (FPS98_06890) | - | 1453833..1454666 (+) | 834 | WP_261376213.1 | RNA ligase family protein | - |
| FPS98_RS06895 (FPS98_06895) | hflX | 1454753..1456045 (+) | 1293 | WP_144614711.1 | GTPase HflX | - |
| FPS98_RS06900 (FPS98_06900) | - | 1456053..1457330 (+) | 1278 | WP_144614713.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| FPS98_RS06905 (FPS98_06905) | - | 1457500..1457910 (+) | 411 | WP_015891641.1 | MerR family transcriptional regulator | - |
| FPS98_RS06910 (FPS98_06910) | glnA | 1457946..1459280 (+) | 1335 | WP_007719084.1 | type I glutamate--ammonia ligase | - |
| FPS98_RS31320 | - | 1459454..1459657 (+) | 204 | Protein_1361 | tyrosine-type recombinase/integrase | - |
| FPS98_RS06920 (FPS98_06920) | - | 1460516..1460899 (-) | 384 | WP_144614717.1 | hypothetical protein | - |
| FPS98_RS30785 | - | 1461043..1461435 (+) | 393 | WP_186380560.1 | hypothetical protein | - |
| FPS98_RS06930 (FPS98_06930) | - | 1461513..1461848 (-) | 336 | WP_144614718.1 | DeoR family transcriptional regulator | - |
| FPS98_RS30790 | - | 1461879..1462043 (+) | 165 | WP_186380561.1 | hypothetical protein | - |
| FPS98_RS06935 (FPS98_06935) | - | 1462108..1462749 (-) | 642 | WP_144614719.1 | hypothetical protein | - |
| FPS98_RS06940 (FPS98_06940) | - | 1462938..1463477 (-) | 540 | WP_144614721.1 | hypothetical protein | - |
| FPS98_RS31800 | - | 1465325..1465504 (+) | 180 | WP_409995172.1 | DNA adenine methylase | - |
| FPS98_RS31325 | - | 1465687..1465968 (+) | 282 | WP_261376269.1 | hypothetical protein | - |
| FPS98_RS06960 (FPS98_06960) | - | 1466023..1466481 (-) | 459 | WP_144614723.1 | hypothetical protein | - |
| FPS98_RS06965 (FPS98_06965) | - | 1467030..1467722 (+) | 693 | WP_144614725.1 | hypothetical protein | - |
| FPS98_RS06970 (FPS98_06970) | - | 1468447..1468704 (+) | 258 | WP_261376127.1 | hypothetical protein | - |
| FPS98_RS06975 (FPS98_06975) | - | 1469253..1470074 (-) | 822 | WP_144614727.1 | DUF6492 family protein | - |
| FPS98_RS06980 (FPS98_06980) | - | 1470849..1471046 (+) | 198 | WP_261376128.1 | hypothetical protein | - |
| FPS98_RS06985 (FPS98_06985) | - | 1471248..1471712 (-) | 465 | WP_144614729.1 | hypothetical protein | - |
| FPS98_RS06990 (FPS98_06990) | - | 1472244..1472526 (+) | 283 | Protein_1376 | SOS response-associated peptidase family protein | - |
| FPS98_RS06995 (FPS98_06995) | arsR | 1472643..1472957 (+) | 315 | WP_144614731.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| FPS98_RS07000 (FPS98_07000) | - | 1473023..1473460 (+) | 438 | WP_015891623.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| FPS98_RS07005 (FPS98_07005) | arsB | 1473479..1474522 (+) | 1044 | WP_144614733.1 | ACR3 family arsenite efflux transporter | - |
| FPS98_RS07010 (FPS98_07010) | arsC | 1474544..1474948 (+) | 405 | WP_144614735.1 | arsenate reductase (thioredoxin) | - |
| FPS98_RS07015 (FPS98_07015) | - | 1475252..1475890 (-) | 639 | WP_144614737.1 | hypothetical protein | - |
| FPS98_RS31705 | - | 1476136..1476234 (+) | 99 | WP_315852074.1 | hypothetical protein | - |
| FPS98_RS07025 (FPS98_07025) | nucA/comI | 1476405..1476833 (-) | 429 | WP_144614739.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| FPS98_RS31330 | - | 1477293..1477466 (+) | 174 | WP_261376129.1 | hypothetical protein | - |
| FPS98_RS07035 (FPS98_07035) | - | 1477594..1477971 (+) | 378 | WP_144614741.1 | PH domain-containing protein | - |
| FPS98_RS07045 (FPS98_07045) | - | 1478477..1478677 (+) | 201 | WP_144614745.1 | hypothetical protein | - |
| FPS98_RS07050 (FPS98_07050) | - | 1479243..1480352 (-) | 1110 | WP_144614747.1 | acyltransferase family protein | - |
| FPS98_RS07055 (FPS98_07055) | - | 1480895..1481599 (+) | 705 | WP_144614749.1 | SOS response-associated peptidase | - |
| FPS98_RS07060 (FPS98_07060) | nucA/comI | 1481646..1482074 (-) | 429 | WP_144614751.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15539.82 Da Isoelectric Point: 7.8452
>NTDB_id=375811 FPS98_RS07060 WP_144614751.1 1481646..1482074(-) (nucA/comI) [Brevibacillus brevis strain HK544]
MTQRKMLTLIVVLLIGAAYLFGLVPIEKQTVSNGNVDHTIVFPSDRYPETAKHIKEAVASGKSAVCTIDRDGADKNREKS
LKGIPTKKGYDRDEWPMAMCAEGGTGADIKYIKPSDNRGAGSWISNQLEDFPDGTKVEIVIK
MTQRKMLTLIVVLLIGAAYLFGLVPIEKQTVSNGNVDHTIVFPSDRYPETAKHIKEAVASGKSAVCTIDRDGADKNREKS
LKGIPTKKGYDRDEWPMAMCAEGGTGADIKYIKPSDNRGAGSWISNQLEDFPDGTKVEIVIK
Nucleotide
Download Length: 429 bp
>NTDB_id=375811 FPS98_RS07060 WP_144614751.1 1481646..1482074(-) (nucA/comI) [Brevibacillus brevis strain HK544]
ATGACACAGAGAAAAATGCTGACGTTGATTGTGGTGCTGCTGATCGGCGCCGCCTATCTCTTTGGACTTGTTCCAATAGA
GAAGCAAACAGTCAGCAATGGGAACGTAGACCATACGATTGTTTTTCCGTCTGATCGATACCCAGAGACTGCAAAGCATA
TAAAAGAAGCGGTTGCTTCCGGGAAGTCAGCTGTATGCACAATTGACCGCGATGGAGCCGATAAAAATCGCGAAAAATCG
CTCAAAGGTATTCCTACAAAAAAGGGGTATGATCGGGATGAATGGCCAATGGCCATGTGTGCAGAGGGTGGCACAGGGGC
AGATATCAAATACATAAAGCCTTCAGATAATCGCGGCGCTGGATCTTGGATATCCAACCAATTAGAGGATTTTCCAGACG
GGACAAAGGTTGAAATCGTGATCAAATAA
ATGACACAGAGAAAAATGCTGACGTTGATTGTGGTGCTGCTGATCGGCGCCGCCTATCTCTTTGGACTTGTTCCAATAGA
GAAGCAAACAGTCAGCAATGGGAACGTAGACCATACGATTGTTTTTCCGTCTGATCGATACCCAGAGACTGCAAAGCATA
TAAAAGAAGCGGTTGCTTCCGGGAAGTCAGCTGTATGCACAATTGACCGCGATGGAGCCGATAAAAATCGCGAAAAATCG
CTCAAAGGTATTCCTACAAAAAAGGGGTATGATCGGGATGAATGGCCAATGGCCATGTGTGCAGAGGGTGGCACAGGGGC
AGATATCAAATACATAAAGCCTTCAGATAATCGCGGCGCTGGATCTTGGATATCCAACCAATTAGAGGATTTTCCAGACG
GGACAAAGGTTGAAATCGTGATCAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
61.667 |
84.507 |
0.521 |