Detailed information    

experimental Experimentally validated

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   BSU_03430 Genome accession   NC_000964
Coordinates   372154..372603 (-) Length   149 a.a.
NCBI ID   NP_388225.3    Uniprot ID   P12667
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   cleavage of dsDNA into ssDNA   
DNA processing

Function


NucA is an integral membrane protein that is regulated by the induction of natural competence. It catalyzes the cleavage of double-stranded DNA (dsDNA) into single-stranded DNA (ssDNA), which is essential for the efficient uptake of transforming DNA. This process allows the cell to internalize and integrate exogenous DNA into its genome.


Genomic Context


Location: 367154..377603
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_03370 (BSU03370) yckA 367305..367985 (-) 681 NP_388219.1 aminoacid ABC transporter (permease subunit) -
  BSU_03380 (BSU03380) yckB 367995..368858 (-) 864 NP_388220.1 amino acid ABC transporter (binding lipoprotein subunit) -
  BSU_03385 (BSU03385) - 369020..369217 (+) 198 YP_009513942.1 hypothetical protein -
  BSU_03390 (BSU03390) yckC 369236..369691 (+) 456 NP_388221.1 conserved integral membrane protein of unknown function -
  BSU_03400 (BSU03400) yckD 369773..370105 (+) 333 NP_388222.1 hypothetical protein -
  BSU_03410 (BSU03410) bglC 370259..371692 (+) 1434 NP_388223.1 aryl-phospho-beta-d-glucosidase -
  BSU_03420 (BSU03420) nin/comJ 371729..372127 (-) 399 NP_388224.1 inhibitor of the DNA degrading activity of NucA (competence) Regulator
  BSU_03430 (BSU03430) nucA/comI 372154..372603 (-) 450 NP_388225.3 endonuclease Machinery gene
  BSU_03440 (BSU03440) tlpC 372771..374492 (-) 1722 NP_388226.2 methyl-accepting chemotaxis protein (plant colonization) -
  BSU_03450 (BSU03450) hxlB 374603..375160 (-) 558 NP_388227.1 6-phospho-3-hexuloisomerase (PHI) -
  BSU_03460 (BSU03460) hxlA 375166..375798 (-) 633 NP_388228.1 3-hexulose-6-phosphate synthase (HPS) -
  BSU_03470 (BSU03470) hxlR 376032..376394 (+) 363 NP_388229.2 positive regulator of hxlAB expression (formaldehyde sensing) -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  nin/comJ nucA/comI negative effect

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16486.48 Da        Isoelectric Point: 4.6274

>NTDB_id=110 BSU_03430 NP_388225.3 372154..372603(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
MNITTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDETMAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGA
EERREQSLKDVPSKKGYDRDEWPMAMCKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ

Nucleotide


Download         Length: 450 bp        

>NTDB_id=110 BSU_03430 NP_388225.3 372154..372603(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
GTGAACATCACGACGGACATCATAAAAACGATACTTCTCGTCATCGTCATCATAGCAGCTGCAGCTGTCGGCCTGATAAA
AGGAGACTTTTTCTCAGCTGATCAAAAAACGTCTCAAACGAAAGAATATGATGAAACAATGGCCTTCCCATCTGACCGGT
ATCCCGAAACTGCCAAGCATATTAAGGATGCGATAAATGAGGGGCACTCAGAGGTGTGCACTATTGACAGAGACGGAGCT
GAAGAACGCCGCGAGCAATCATTAAAGGACGTACCTTCCAAAAAGGGGTATGACAGAGATGAATGGCCAATGGCCATGTG
CAAAGAAGGCGGTGAGGGAGCTTCTGTAGAATACATTTCTCCCGCTGACAACCGCGGAGCAGGCTCTTGGGTCGGGCATC
GGCTTACCGATTACCCAGACGGCACAAAGGTTTTATTCACAATTCAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P12667

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Jeanette Hahn et al. (2021) Mechanisms of Transforming DNA Uptake to the Periplasm of Bacillus subtilis. MBio 12(3):e0106121. [PMID: 34126763]
[2] Hanne Jarmer et al. (2002) Transcriptome analysis documents induced competence of Bacillus subtilis during nitrogen limiting conditions. FEMS Microbiology Letters 206(2):197-200. [PMID: 11814663]
[3] R Provvedi et al. (2001) NucA is required for DNA cleavage during transformation of Bacillus subtilis. Molecular Microbiology 40(3):634-44. [PMID: 11359569]
[4] D van Sinderen et al. (1995) Differential expression of two closely related deoxyribonuclease genes, nucA and nucB, in Bacillus subtilis. Molecular Microbiology 15(2):213-23. [PMID: 7746143]