Detailed information    

experimental Experimentally validated

Overview

Name   nin/comJ   Type   Regulator
Locus tag   BSU_03420 Genome accession   NC_000964
Coordinates   371729..372127 (-) Length   132 a.a.
NCBI ID   NP_388224.1    Uniprot ID   P12669
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   represses the expression of nucA   
Competence regulation

Function

The nin gene product, Nin, is known to inhibit the activity of the nuclease encoded by nucA.


Genomic Context

Location: 366729..377127
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_03370 (BSU03370) yckA 367305..367985 (-) 681 NP_388219.1 aminoacid ABC transporter (permease subunit) -
  BSU_03380 (BSU03380) yckB 367995..368858 (-) 864 NP_388220.1 amino acid ABC transporter (binding lipoprotein subunit) -
  BSU_03385 (BSU03385) - 369020..369217 (+) 198 YP_009513942.1 hypothetical protein -
  BSU_03390 (BSU03390) yckC 369236..369691 (+) 456 NP_388221.1 conserved integral membrane protein of unknown function -
  BSU_03400 (BSU03400) yckD 369773..370105 (+) 333 NP_388222.1 hypothetical protein -
  BSU_03410 (BSU03410) bglC 370259..371692 (+) 1434 NP_388223.1 aryl-phospho-beta-d-glucosidase -
  BSU_03420 (BSU03420) nin/comJ 371729..372127 (-) 399 NP_388224.1 inhibitor of the DNA degrading activity of NucA (competence) Regulator
  BSU_03430 (BSU03430) nucA/comI 372154..372603 (-) 450 NP_388225.3 endonuclease Machinery gene
  BSU_03440 (BSU03440) tlpC 372771..374492 (-) 1722 NP_388226.2 methyl-accepting chemotaxis protein (plant colonization) -
  BSU_03450 (BSU03450) hxlB 374603..375160 (-) 558 NP_388227.1 6-phospho-3-hexuloisomerase (PHI) -
  BSU_03460 (BSU03460) hxlA 375166..375798 (-) 633 NP_388228.1 3-hexulose-6-phosphate synthase (HPS) -
  BSU_03470 (BSU03470) hxlR 376032..376394 (+) 363 NP_388229.2 positive regulator of hxlAB expression (formaldehyde sensing) -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  nin/comJ nucA/comI negative effect

Sequence

Protein


Download         Length: 132 a.a.        Molecular weight: 14996.95 Da        Isoelectric Point: 4.8991

>NTDB_id=111 BSU_03420 NP_388224.1 371729..372127(-) (nin/comJ) [Bacillus subtilis subsp. subtilis str. 168]
MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPF
HVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDLHADTYIIDAVSV

Nucleotide


Download         Length: 399 bp        

>NTDB_id=111 BSU_03420 NP_388224.1 371729..372127(-) (nin/comJ) [Bacillus subtilis subsp. subtilis str. 168]
TTGATCAAATCATGGAAGCCGCAAGAACTTTCGATTTCATATCATCAATTTACTGTATTTCAAAAGGATTCTACACCTCC
TGTAATGGATTGGACTGACGAAGCGATTGAAAAAGGATATGCTGCGGCAGACGGAGCCATTTCCTTTGAGGCACAGCGAA
ATACAAAGGCCTTTATTCTTTTTCGCCTGAACAGTTCAGAAACAGTAAACTCCTACGAAAAAAAAGTGACTGTTCCTTTT
CATGTCACAGAAAACGGAATTCATATTGAAAGCATCATGTCTAAAAGACTGTCCTTTGATCTGCCTAAAGGAGACTATCA
ATTGACATGCTGGACTGTGCCGGCTGAAATGTCAGATTTGCACGCCGACACTTATATTATTGATGCTGTTTCTGTGTAA

Domains

Predicted by InterproScan.

Competence protein J (ComJ) (ComJ)

(9-129)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  PDB 4MQD

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Hanne Jarmer et al. (2002) Transcriptome analysis documents induced competence of Bacillus subtilis during nitrogen limiting conditions. FEMS Microbiology Letters 206(2):197-200. [PMID: 11814663]
[2] R Provvedi et al. (2001) NucA is required for DNA cleavage during transformation of Bacillus subtilis. Molecular Microbiology 40(3):634-44. [PMID: 11359569]