Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   G4G26_RS16045 Genome accession   NZ_CP049924
Coordinates   3119612..3119752 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain So1b     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3114612..3124752
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4G26_RS16020 (G4G26_16075) yuxO 3114888..3115268 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  G4G26_RS16025 (G4G26_16080) comA 3115287..3115931 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  G4G26_RS16030 (G4G26_16085) comP 3116012..3118324 (-) 2313 WP_068947635.1 histidine kinase Regulator
  G4G26_RS16035 (G4G26_16090) comX 3118340..3118561 (-) 222 WP_014114983.1 competence pheromone ComX -
  G4G26_RS16040 (G4G26_16095) comQ 3118558..3119427 (-) 870 WP_015714626.1 polyprenyl synthetase family protein Regulator
  G4G26_RS16045 (G4G26_16100) degQ 3119612..3119752 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  G4G26_RS16050 (G4G26_16105) - 3119974..3120099 (+) 126 WP_141770195.1 hypothetical protein -
  G4G26_RS16055 (G4G26_16110) - 3120214..3120582 (+) 369 WP_014477834.1 hypothetical protein -
  G4G26_RS16060 (G4G26_16115) pdeH 3120558..3121787 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  G4G26_RS16065 (G4G26_16120) pncB 3121924..3123396 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  G4G26_RS16070 (G4G26_16125) pncA 3123412..3123963 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  G4G26_RS16075 (G4G26_16130) yueI 3124060..3124458 (-) 399 WP_088467369.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=375689 G4G26_RS16045 WP_003220708.1 3119612..3119752(-) (degQ) [Bacillus subtilis strain So1b]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=375689 G4G26_RS16045 WP_003220708.1 3119612..3119752(-) (degQ) [Bacillus subtilis strain So1b]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1