Detailed information NTG0373588

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: G6536_RS13265
• Genome accession: NZ_CP049330
• Coordinates: 2572353..2572790 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain CP6
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2567353..2577790

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
G6536_RS13215 (G6536_13405)	sinI	2567528..2567704 (+)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator
G6536_RS13220 (G6536_13410)	sinR	2567738..2568073 (+)	336	WP_025804940.1	helix-turn-helix domain-containing protein	Regulator
G6536_RS13225 (G6536_13415)	-	2568178..2568972 (-)	795	WP_003183447.1	TasA family protein	-
G6536_RS13230 (G6536_13420)	-	2569046..2569630 (-)	585	WP_003183449.1	signal peptidase I	-
G6536_RS13235 (G6536_13425)	tapA	2569627..2570355 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
G6536_RS13240 (G6536_13430)	-	2570665..2570952 (+)	288	WP_223307118.1	YqzG/YhdC family protein	-
G6536_RS13245 (G6536_13435)	-	2570976..2571158 (-)	183	WP_003183456.1	YqzE family protein	-
G6536_RS13250 (G6536_13440)	comGG	2571247..2571612 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
G6536_RS13255 (G6536_13445)	comGF	2571625..2572113 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
G6536_RS13260 (G6536_13450)	comGE	2572022..2572369 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
G6536_RS13265 (G6536_13455)	comGD	2572353..2572790 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
G6536_RS13270 (G6536_13460)	comGC	2572796..2573089 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
G6536_RS13275 (G6536_13465)	comGB	2573103..2574137 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
G6536_RS13280 (G6536_13470)	comGA	2574127..2575191 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
G6536_RS13285 (G6536_13475)	-	2575348..2576187 (-)	840	WP_003183480.1	STAS domain-containing protein	-
G6536_RS13295 (G6536_13485)	-	2576429..2576806 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
G6536_RS13300 (G6536_13490)	-	2577015..2577260 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=373588 G6536_RS13265 WP_009327905.1 2572353..2572790(-) (comGD) [Bacillus licheniformis strain CP6]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=373588 G6536_RS13265 WP_009327905.1 2572353..2572790(-) (comGD) [Bacillus licheniformis strain CP6]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393