Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   FOG69_RS12045 Genome accession   NZ_CP041693
Coordinates   2338454..2338831 (-) Length   125 a.a.
NCBI ID   WP_013352867.1    Uniprot ID   A0A9P1JIN8
Organism   Bacillus amyloliquefaciens strain H     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2333454..2343831
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOG69_RS12005 (FOG69_12005) - 2333952..2334746 (+) 795 WP_013352859.1 YqhG family protein -
  FOG69_RS12010 (FOG69_12010) sinI 2334926..2335099 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  FOG69_RS12015 (FOG69_12015) sinR 2335133..2335468 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  FOG69_RS12020 (FOG69_12020) tasA 2335516..2336301 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  FOG69_RS12025 (FOG69_12025) sipW 2336366..2336950 (-) 585 WP_013352863.1 signal peptidase I SipW -
  FOG69_RS12030 (FOG69_12030) tapA 2336922..2337593 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  FOG69_RS12035 (FOG69_12035) - 2337851..2338180 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  FOG69_RS12040 (FOG69_12040) - 2338221..2338400 (-) 180 WP_013352866.1 YqzE family protein -
  FOG69_RS12045 (FOG69_12045) comGG 2338454..2338831 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  FOG69_RS12050 (FOG69_12050) comGF 2338833..2339333 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  FOG69_RS12055 (FOG69_12055) comGE 2339242..2339556 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  FOG69_RS12060 (FOG69_12060) comGD 2339540..2339977 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  FOG69_RS12065 (FOG69_12065) comGC 2339967..2340275 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  FOG69_RS12070 (FOG69_12070) comGB 2340280..2341317 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  FOG69_RS12075 (FOG69_12075) comGA 2341304..2342374 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  FOG69_RS12080 (FOG69_12080) - 2342568..2343518 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.18 Da        Isoelectric Point: 10.2027

>NTDB_id=373192 FOG69_RS12045 WP_013352867.1 2338454..2338831(-) (comGG) [Bacillus amyloliquefaciens strain H]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMIQGQKTQSGTQRFPYGTVS
FYINGNDRRETVQVTIKAVTASGTRREAHLLFNHKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=373192 FOG69_RS12045 WP_013352867.1 2338454..2338831(-) (comGG) [Bacillus amyloliquefaciens strain H]
ATGTACAAATCTGACGGGTTTATATATCCGGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGTGAGAACCTGCTTCAAAACGGCG
CACTGCTGTCAAGCCGTCATATGATACAGGGACAAAAGACTCAGTCGGGCACACAGCGTTTTCCGTACGGAACCGTCTCC
TTTTACATCAACGGGAACGATCGCCGGGAAACGGTTCAAGTTACAATAAAGGCGGTAACAGCATCAGGGACGAGACGGGA
GGCTCACCTTTTATTCAATCATAAGAAGAAACAGCTGATTCAATGGACAGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment