Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FOG69_RS12010 | Genome accession | NZ_CP041693 |
| Coordinates | 2334926..2335099 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain H | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2329926..2340099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOG69_RS11995 (FOG69_11995) | gcvT | 2330737..2331837 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FOG69_RS12000 (FOG69_12000) | - | 2332261..2333931 (+) | 1671 | WP_014470658.1 | DEAD/DEAH box helicase | - |
| FOG69_RS12005 (FOG69_12005) | - | 2333952..2334746 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| FOG69_RS12010 (FOG69_12010) | sinI | 2334926..2335099 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| FOG69_RS12015 (FOG69_12015) | sinR | 2335133..2335468 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| FOG69_RS12020 (FOG69_12020) | tasA | 2335516..2336301 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| FOG69_RS12025 (FOG69_12025) | sipW | 2336366..2336950 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| FOG69_RS12030 (FOG69_12030) | tapA | 2336922..2337593 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FOG69_RS12035 (FOG69_12035) | - | 2337851..2338180 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| FOG69_RS12040 (FOG69_12040) | - | 2338221..2338400 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| FOG69_RS12045 (FOG69_12045) | comGG | 2338454..2338831 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FOG69_RS12050 (FOG69_12050) | comGF | 2338833..2339333 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| FOG69_RS12055 (FOG69_12055) | comGE | 2339242..2339556 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FOG69_RS12060 (FOG69_12060) | comGD | 2339540..2339977 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=373190 FOG69_RS12010 WP_013352860.1 2334926..2335099(+) (sinI) [Bacillus amyloliquefaciens strain H]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=373190 FOG69_RS12010 WP_013352860.1 2334926..2335099(+) (sinI) [Bacillus amyloliquefaciens strain H]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |