Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   FIM06_RS15375 Genome accession   NZ_CP041144
Coordinates   3071362..3071502 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain UCMB5044     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3066362..3076502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FIM06_RS15350 (FIM06_2856) - 3066701..3067084 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  FIM06_RS15355 (FIM06_2857) comA 3067106..3067750 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  FIM06_RS15360 (FIM06_2858) comP 3067831..3070122 (-) 2292 WP_140995956.1 histidine kinase Regulator
  FIM06_RS15365 comX 3070134..3070298 (-) 165 WP_007613432.1 competence pheromone ComX -
  FIM06_RS15370 (FIM06_2859) - 3070298..3071209 (-) 912 WP_079891857.1 polyprenyl synthetase family protein -
  FIM06_RS15375 (FIM06_2860) degQ 3071362..3071502 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FIM06_RS15385 (FIM06_2862) - 3071968..3072309 (+) 342 WP_007613435.1 hypothetical protein -
  FIM06_RS15390 (FIM06_2863) - 3072316..3073539 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  FIM06_RS15395 (FIM06_2864) - 3073669..3075135 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  FIM06_RS15400 (FIM06_2865) - 3075153..3075704 (-) 552 WP_105937377.1 cysteine hydrolase family protein -
  FIM06_RS15405 (FIM06_2866) - 3075801..3076199 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=369771 FIM06_RS15375 WP_003152043.1 3071362..3071502(-) (degQ) [Bacillus velezensis strain UCMB5044]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=369771 FIM06_RS15375 WP_003152043.1 3071362..3071502(-) (degQ) [Bacillus velezensis strain UCMB5044]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment