Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   FG051_RS05370 Genome accession   NZ_CP040736
Coordinates   1087234..1087734 (+) Length   166 a.a.
NCBI ID   WP_057814674.1    Uniprot ID   A0A5B7T340
Organism   Companilactobacillus futsaii strain Y97     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1074093..1126426 1087234..1087734 within 0


Gene organization within MGE regions


Location: 1074093..1126426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FG051_RS05280 (FG051_05280) galE 1074093..1075082 (-) 990 WP_057814987.1 UDP-glucose 4-epimerase GalE -
  FG051_RS05285 (FG051_05285) - 1075230..1075889 (+) 660 WP_083484628.1 class A sortase -
  FG051_RS05290 (FG051_05290) recJ 1075981..1078290 (+) 2310 WP_057814983.1 single-stranded-DNA-specific exonuclease RecJ -
  FG051_RS05295 (FG051_05295) - 1078313..1078831 (+) 519 WP_010019526.1 adenine phosphoribosyltransferase -
  FG051_RS05305 (FG051_05305) - 1079151..1080299 (-) 1149 WP_057814980.1 tyrosine-type recombinase/integrase -
  FG051_RS05310 (FG051_05310) - 1080448..1080846 (-) 399 WP_057814978.1 ImmA/IrrE family metallo-endopeptidase -
  FG051_RS05315 (FG051_05315) - 1080821..1081216 (-) 396 WP_057814976.1 helix-turn-helix transcriptional regulator -
  FG051_RS05320 (FG051_05320) - 1081361..1081579 (+) 219 WP_057814974.1 helix-turn-helix transcriptional regulator -
  FG051_RS05325 (FG051_05325) - 1081688..1082170 (+) 483 WP_057814972.1 hypothetical protein -
  FG051_RS05330 (FG051_05330) - 1082176..1082505 (+) 330 WP_057814970.1 DUF771 domain-containing protein -
  FG051_RS05335 (FG051_05335) - 1082506..1082760 (+) 255 WP_057814968.1 hypothetical protein -
  FG051_RS05340 (FG051_05340) - 1082941..1083831 (+) 891 WP_244937291.1 recombinase RecT -
  FG051_RS05345 (FG051_05345) - 1083812..1084615 (+) 804 WP_187323369.1 PD-(D/E)XK nuclease-like domain-containing protein -
  FG051_RS05350 (FG051_05350) - 1084627..1085496 (+) 870 WP_083484612.1 DnaD domain protein -
  FG051_RS13395 - 1085483..1085773 (+) 291 WP_057814667.1 hypothetical protein -
  FG051_RS13720 (FG051_05355) - 1085736..1085972 (+) 237 WP_420838809.1 helix-turn-helix domain-containing protein -
  FG051_RS05360 (FG051_05360) - 1086069..1086500 (+) 432 WP_057814669.1 RusA family crossover junction endodeoxyribonuclease -
  FG051_RS05365 (FG051_05365) - 1086497..1087234 (+) 738 WP_057814671.1 Rha family transcriptional regulator -
  FG051_RS05370 (FG051_05370) ssb 1087234..1087734 (+) 501 WP_057814674.1 single-stranded DNA-binding protein Machinery gene
  FG051_RS05375 (FG051_05375) - 1087944..1088153 (+) 210 WP_010019123.1 hypothetical protein -
  FG051_RS05380 (FG051_05380) - 1088384..1088569 (+) 186 WP_010019127.1 hypothetical protein -
  FG051_RS05385 (FG051_05385) - 1088579..1088797 (+) 219 WP_149029830.1 hypothetical protein -
  FG051_RS13660 - 1088781..1088903 (+) 123 WP_268750941.1 hypothetical protein -
  FG051_RS05390 (FG051_05390) - 1089110..1089331 (+) 222 WP_057815926.1 hypothetical protein -
  FG051_RS05395 (FG051_05395) - 1089357..1089620 (+) 264 WP_057815928.1 hypothetical protein -
  FG051_RS05400 (FG051_05400) - 1089773..1090225 (+) 453 WP_187323370.1 ArpU family phage packaging/lysis transcriptional regulator -
  FG051_RS05405 (FG051_05405) - 1090547..1090810 (+) 264 WP_057815931.1 DUF6275 family protein -
  FG051_RS05410 (FG051_05410) - 1091632..1092123 (+) 492 WP_057815933.1 hypothetical protein -
  FG051_RS05415 (FG051_05415) - 1092071..1093420 (+) 1350 WP_057815935.1 PBSX family phage terminase large subunit -
  FG051_RS05420 (FG051_05420) - 1093442..1094974 (+) 1533 WP_057815937.1 phage portal protein -
  FG051_RS05425 (FG051_05425) - 1094989..1096467 (+) 1479 WP_244937292.1 phage minor capsid protein -
  FG051_RS05430 (FG051_05430) - 1096469..1096669 (+) 201 WP_057815939.1 hypothetical protein -
  FG051_RS05435 (FG051_05435) - 1096771..1097343 (+) 573 WP_057815941.1 phage scaffolding protein -
  FG051_RS05440 (FG051_05440) - 1097366..1098253 (+) 888 WP_057815943.1 hypothetical protein -
  FG051_RS05445 (FG051_05445) - 1098291..1098701 (+) 411 WP_222838313.1 hypothetical protein -
  FG051_RS05450 (FG051_05450) - 1098724..1099047 (+) 324 WP_057816052.1 putative minor capsid protein -
  FG051_RS05455 (FG051_05455) - 1099048..1099410 (+) 363 WP_235526940.1 minor capsid protein -
  FG051_RS05460 (FG051_05460) - 1099394..1099789 (+) 396 WP_057815948.1 phage tail terminator protein -
  FG051_RS05465 (FG051_05465) - 1099802..1100362 (+) 561 WP_057815950.1 phage tail tube protein -
  FG051_RS05470 (FG051_05470) - 1100446..1100841 (+) 396 WP_057815952.1 hypothetical protein -
  FG051_RS05475 (FG051_05475) - 1100906..1101484 (+) 579 WP_187323371.1 Gp15 family bacteriophage protein -
  FG051_RS05480 (FG051_05480) - 1101517..1106358 (+) 4842 WP_057815955.1 tape measure protein -
  FG051_RS05485 (FG051_05485) - 1106358..1107185 (+) 828 WP_057815957.1 phage tail domain-containing protein -
  FG051_RS05490 (FG051_05490) - 1107198..1108379 (+) 1182 WP_057815959.1 prophage endopeptidase tail family protein -
  FG051_RS05495 (FG051_05495) - 1108372..1109823 (+) 1452 WP_057815961.1 hypothetical protein -
  FG051_RS05500 (FG051_05500) - 1109833..1110288 (+) 456 WP_057815963.1 hypothetical protein -
  FG051_RS05505 (FG051_05505) - 1110288..1111727 (+) 1440 WP_057815965.1 BppU family phage baseplate upper protein -
  FG051_RS05510 (FG051_05510) - 1111772..1112044 (+) 273 WP_057815967.1 hypothetical protein -
  FG051_RS05515 (FG051_05515) - 1112048..1112347 (+) 300 WP_057815968.1 holin -
  FG051_RS05520 (FG051_05520) - 1112365..1113360 (+) 996 WP_057815970.1 peptidoglycan recognition protein family protein -
  FG051_RS05525 (FG051_05525) - 1113376..1114167 (+) 792 WP_057815972.1 hypothetical protein -
  FG051_RS05530 (FG051_05530) - 1114170..1114829 (+) 660 WP_057815974.1 hypothetical protein -
  FG051_RS05535 (FG051_05535) - 1114880..1116370 (-) 1491 WP_057815975.1 DUF6056 family protein -
  FG051_RS05540 (FG051_05540) - 1116725..1117678 (-) 954 WP_083484650.1 SAP domain-containing protein -
  FG051_RS05545 (FG051_05545) - 1117733..1117939 (-) 207 WP_057815980.1 hypothetical protein -
  FG051_RS05550 (FG051_05550) - 1117976..1118470 (-) 495 WP_057815982.1 hypothetical protein -
  FG051_RS05555 (FG051_05555) - 1118947..1119717 (-) 771 WP_057815984.1 ion channel -
  FG051_RS05560 (FG051_05560) - 1119837..1120616 (+) 780 WP_057815986.1 TraX family protein -
  FG051_RS05565 (FG051_05565) - 1120650..1122602 (+) 1953 WP_057815988.1 elongation factor G -
  FG051_RS05570 (FG051_05570) - 1122558..1122848 (-) 291 WP_057815990.1 hypothetical protein -
  FG051_RS05575 (FG051_05575) - 1122980..1123405 (+) 426 WP_057815992.1 universal stress protein -
  FG051_RS05580 (FG051_05580) - 1123448..1123972 (-) 525 WP_057815994.1 phosphatidylglycerophosphatase A -
  FG051_RS05585 (FG051_05585) - 1123989..1124645 (-) 657 WP_057815995.1 HD domain-containing protein -
  FG051_RS05590 (FG051_05590) - 1124763..1125326 (+) 564 WP_057815997.1 peroxiredoxin -
  FG051_RS05595 (FG051_05595) pnuC 1125677..1126426 (+) 750 WP_057815999.1 nicotinamide riboside transporter PnuC -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18724.50 Da        Isoelectric Point: 7.1659

>NTDB_id=366864 FG051_RS05370 WP_057814674.1 1087234..1087734(+) (ssb) [Companilactobacillus futsaii strain Y97]
MINRTVLVGRLTRDPELRYTTNGAAVASFTLAVNRQFTNSQGARETDFINCVIWRKAAENFSNFTHKGSLVGLDGRIQTR
NYENQQGQRVYVTEVVVENFSLLESRKDAENQQQNSSNTNDYSHQPPKKSRNDAVNTKSDVANSKSGDPFYNNSKPIDIS
DDDLPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=366864 FG051_RS05370 WP_057814674.1 1087234..1087734(+) (ssb) [Companilactobacillus futsaii strain Y97]
ATGATTAATCGAACAGTCCTAGTAGGACGCCTAACACGTGATCCAGAGTTGAGATATACAACTAATGGTGCAGCAGTAGC
AAGCTTCACACTAGCAGTAAACAGGCAATTCACTAATTCTCAAGGTGCACGTGAGACCGATTTTATCAATTGTGTCATTT
GGCGAAAAGCTGCTGAGAATTTTTCTAATTTCACTCACAAAGGTTCACTTGTAGGACTTGATGGACGAATTCAAACACGT
AACTACGAGAATCAGCAAGGACAGCGTGTATATGTCACTGAAGTAGTTGTTGAGAACTTCTCACTTTTGGAAAGTAGAAA
AGATGCAGAAAATCAGCAGCAAAATTCCAGTAATACCAACGACTACAGCCATCAACCGCCGAAAAAAAGTAGAAACGATG
CAGTAAACACAAAAAGTGATGTAGCAAATTCAAAGAGCGGTGATCCATTTTATAACAACAGCAAACCAATAGATATTTCA
GATGACGATTTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5B7T340

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

64.118

100

0.657

  ssbA Bacillus subtilis subsp. subtilis str. 168

58.14

100

0.602

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

63.855

0.361


Multiple sequence alignment