Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   FGE23_RS07010 Genome accession   NZ_CP040672
Coordinates   1385021..1385140 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain X030     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 1380021..1390140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGE23_RS06995 - 1381633..1382316 (+) 684 WP_094247243.1 response regulator transcription factor -
  FGE23_RS07000 - 1382303..1383736 (+) 1434 WP_162008365.1 HAMP domain-containing sensor histidine kinase -
  FGE23_RS07005 rapC 1383889..1385037 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  FGE23_RS07010 phrC 1385021..1385140 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  FGE23_RS07015 - 1385290..1385400 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  FGE23_RS07020 - 1385480..1386844 (-) 1365 WP_146276115.1 aspartate kinase -
  FGE23_RS07025 ceuB 1387259..1388212 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  FGE23_RS07030 - 1388202..1389149 (+) 948 WP_077721797.1 iron chelate uptake ABC transporter family permease subunit -
  FGE23_RS07035 - 1389143..1389901 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=366353 FGE23_RS07010 WP_003156334.1 1385021..1385140(+) (phrC) [Bacillus amyloliquefaciens strain X030]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=366353 FGE23_RS07010 WP_003156334.1 1385021..1385140(+) (phrC) [Bacillus amyloliquefaciens strain X030]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment