Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   SMUNN2025_RS01290 Genome accession   NC_013928
Coordinates   264721..264861 (-) Length   46 a.a.
NCBI ID   WP_012997567.1    Uniprot ID   -
Organism   Streptococcus mutans NN2025     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 259721..269861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMUNN2025_RS01270 (SmuNN2025_0232) - 260728..261354 (+) 627 WP_002277685.1 hypothetical protein -
  SMUNN2025_RS01275 (SmuNN2025_0233) - 261402..262040 (+) 639 WP_002262115.1 VTT domain-containing protein -
  SMUNN2025_RS01280 (SmuNN2025_0234) comE/blpR 262505..263257 (+) 753 WP_012997565.1 response regulator transcription factor Regulator
  SMUNN2025_RS01285 (SmuNN2025_0235) comD/blpH 263254..264579 (+) 1326 WP_041160308.1 sensor histidine kinase Regulator
  SMUNN2025_RS01290 (SmuNN2025_0236) comC/blpC 264721..264861 (-) 141 WP_012997567.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  SMUNN2025_RS01295 (SmuNN2025_0237) cipB 265128..265358 (+) 231 WP_012997568.1 Blp family class II bacteriocin Regulator
  SMUNN2025_RS01300 (SmuNN2025_0238) - 265489..265890 (+) 402 WP_002310604.1 hypothetical protein -
  SMUNN2025_RS01305 (SmuNN2025_0240) - 267270..267689 (+) 420 WP_002263913.1 hypothetical protein -
  SMUNN2025_RS01310 (SmuNN2025_0241) - 267836..268240 (+) 405 WP_002263912.1 hypothetical protein -
  SMUNN2025_RS10600 - 268363..268575 (-) 213 Protein_237 IS3 family transposase -
  SMUNN2025_RS10505 - 269015..269179 (+) 165 WP_002265308.1 hypothetical protein -
  SMUNN2025_RS01320 (SmuNN2025_0245) - 269584..269796 (+) 213 WP_002264173.1 Blp family class II bacteriocin -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5194.08 Da        Isoelectric Point: 10.9123

>NTDB_id=36571 SMUNN2025_RS01290 WP_012997567.1 264721..264861(-) (comC/blpC) [Streptococcus mutans NN2025]
MKKTPSLKNDFKKIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=36571 SMUNN2025_RS01290 WP_012997567.1 264721..264861(-) (comC/blpC) [Streptococcus mutans NN2025]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAAAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

95.652

100

0.957

Multiple sequence alignment