Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   FC605_RS12480 Genome accession   NZ_CP040528
Coordinates   2433092..2433475 (-) Length   127 a.a.
NCBI ID   WP_080529536.1    Uniprot ID   -
Organism   Bacillus subtilis strain PR10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2428092..2438475
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FC605_RS12440 (FC605_12440) sinI 2429026..2429199 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FC605_RS12445 (FC605_12445) sinR 2429233..2429568 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FC605_RS12450 (FC605_12450) tasA 2429661..2430446 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  FC605_RS12455 (FC605_12455) sipW 2430510..2431082 (-) 573 WP_003230181.1 signal peptidase I SipW -
  FC605_RS12460 (FC605_12460) tapA 2431066..2431827 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  FC605_RS12465 (FC605_12465) yqzG 2432099..2432425 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  FC605_RS12470 (FC605_12470) spoIITA 2432467..2432646 (-) 180 WP_014480252.1 YqzE family protein -
  FC605_RS12475 (FC605_12475) comGG 2432717..2433091 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  FC605_RS12480 (FC605_12480) comGF 2433092..2433475 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  FC605_RS12485 (FC605_12485) comGE 2433501..2433848 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  FC605_RS12490 (FC605_12490) comGD 2433832..2434263 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  FC605_RS12495 (FC605_12495) comGC 2434253..2434549 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  FC605_RS12500 (FC605_12500) comGB 2434563..2435600 (-) 1038 WP_080529539.1 comG operon protein ComGB Machinery gene
  FC605_RS12505 (FC605_12505) comGA 2435587..2436657 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  FC605_RS12510 (FC605_12510) - 2436870..2437067 (-) 198 WP_080529540.1 hypothetical protein -
  FC605_RS12515 (FC605_12515) corA 2437069..2438022 (-) 954 WP_080529541.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14414.53 Da        Isoelectric Point: 6.2135

>NTDB_id=365020 FC605_RS12480 WP_080529536.1 2433092..2433475(-) (comGF) [Bacillus subtilis strain PR10]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=365020 FC605_RS12480 WP_080529536.1 2433092..2433475(-) (comGF) [Bacillus subtilis strain PR10]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.206

99.213

0.984


Multiple sequence alignment