Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FC605_RS12440 Genome accession   NZ_CP040528
Coordinates   2429026..2429199 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PR10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2424026..2434199
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FC605_RS12425 (FC605_12425) gcvT 2424826..2425914 (-) 1089 WP_080529534.1 glycine cleavage system aminomethyltransferase GcvT -
  FC605_RS12430 (FC605_12430) hepAA 2426355..2428028 (+) 1674 WP_080529535.1 SNF2-related protein -
  FC605_RS12435 (FC605_12435) yqhG 2428049..2428843 (+) 795 WP_003230200.1 YqhG family protein -
  FC605_RS12440 (FC605_12440) sinI 2429026..2429199 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FC605_RS12445 (FC605_12445) sinR 2429233..2429568 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FC605_RS12450 (FC605_12450) tasA 2429661..2430446 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  FC605_RS12455 (FC605_12455) sipW 2430510..2431082 (-) 573 WP_003230181.1 signal peptidase I SipW -
  FC605_RS12460 (FC605_12460) tapA 2431066..2431827 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  FC605_RS12465 (FC605_12465) yqzG 2432099..2432425 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  FC605_RS12470 (FC605_12470) spoIITA 2432467..2432646 (-) 180 WP_014480252.1 YqzE family protein -
  FC605_RS12475 (FC605_12475) comGG 2432717..2433091 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  FC605_RS12480 (FC605_12480) comGF 2433092..2433475 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  FC605_RS12485 (FC605_12485) comGE 2433501..2433848 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=365017 FC605_RS12440 WP_003230187.1 2429026..2429199(+) (sinI) [Bacillus subtilis strain PR10]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=365017 FC605_RS12440 WP_003230187.1 2429026..2429199(+) (sinI) [Bacillus subtilis strain PR10]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment