Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   FE321_RS06440 Genome accession   NZ_CP040424
Coordinates   1363835..1364272 (-) Length   145 a.a.
NCBI ID   WP_208954934.1    Uniprot ID   -
Organism   Dolosigranulum pigrum strain KPL3033     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1335141..1372355 1363835..1364272 within 0


Gene organization within MGE regions


Location: 1335141..1372355
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FE321_RS06255 (FE321_06235) - 1335141..1336157 (-) 1017 WP_208954899.1 N-acetylmuramoyl-L-alanine amidase -
  FE321_RS06260 (FE321_06240) - 1336210..1336536 (-) 327 WP_208954900.1 hypothetical protein -
  FE321_RS06265 (FE321_06245) - 1336594..1336926 (-) 333 WP_208954901.1 hypothetical protein -
  FE321_RS06270 (FE321_06250) - 1336930..1337742 (-) 813 WP_208954902.1 hypothetical protein -
  FE321_RS06275 (FE321_06255) - 1337742..1338530 (-) 789 WP_208954903.1 hypothetical protein -
  FE321_RS06280 (FE321_06260) - 1338543..1339172 (-) 630 WP_208954904.1 hypothetical protein -
  FE321_RS06285 (FE321_06265) - 1339196..1339390 (-) 195 WP_244359440.1 phage holin -
  FE321_RS06290 (FE321_06270) - 1339371..1339766 (-) 396 WP_111974395.1 hypothetical protein -
  FE321_RS09345 - 1339769..1339903 (-) 135 WP_280115904.1 hypothetical protein -
  FE321_RS06295 (FE321_06275) - 1339905..1340306 (-) 402 WP_208954905.1 hypothetical protein -
  FE321_RS06300 (FE321_06280) - 1340306..1342141 (-) 1836 WP_208954906.1 DUF859 family phage minor structural protein -
  FE321_RS06305 (FE321_06285) - 1342154..1346335 (-) 4182 WP_208954907.1 phage tail spike protein -
  FE321_RS06310 (FE321_06290) - 1346332..1347996 (-) 1665 WP_208954908.1 distal tail protein Dit -
  FE321_RS06315 (FE321_06295) - 1347996..1350314 (-) 2319 WP_208954909.1 phage tail protein -
  FE321_RS06320 (FE321_06300) - 1350256..1350663 (-) 408 WP_244359442.1 hypothetical protein -
  FE321_RS06325 (FE321_06305) - 1350702..1350962 (-) 261 WP_208954911.1 hypothetical protein -
  FE321_RS06330 (FE321_06310) - 1350964..1351533 (-) 570 WP_208954912.1 phage tail protein -
  FE321_RS06335 (FE321_06315) - 1351534..1351881 (-) 348 WP_208954913.1 hypothetical protein -
  FE321_RS06340 (FE321_06320) - 1351878..1352129 (-) 252 WP_208954914.1 hypothetical protein -
  FE321_RS06345 (FE321_06325) - 1352122..1352463 (-) 342 WP_208954915.1 hypothetical protein -
  FE321_RS06350 (FE321_06330) - 1352405..1352842 (-) 438 WP_208954916.1 phage Gp19/Gp15/Gp42 family protein -
  FE321_RS09350 - 1352842..1352976 (-) 135 WP_258392299.1 hypothetical protein -
  FE321_RS06355 (FE321_06335) - 1352976..1353872 (-) 897 WP_208954917.1 phage major capsid protein -
  FE321_RS06360 (FE321_06340) - 1353878..1354357 (-) 480 WP_208954918.1 DUF4355 domain-containing protein -
  FE321_RS06365 (FE321_06345) - 1354437..1355828 (-) 1392 WP_208954919.1 terminase large subunit -
  FE321_RS06370 (FE321_06350) - 1355916..1356116 (-) 201 WP_208954920.1 hypothetical protein -
  FE321_RS06375 (FE321_06355) - 1356120..1357604 (-) 1485 WP_208954921.1 hypothetical protein -
  FE321_RS06380 (FE321_06360) - 1357597..1358859 (-) 1263 WP_208954922.1 phage portal protein -
  FE321_RS06385 (FE321_06365) - 1358962..1359300 (-) 339 WP_208954923.1 HNH endonuclease signature motif containing protein -
  FE321_RS06390 (FE321_06370) - 1359383..1359784 (-) 402 WP_208954924.1 DUF722 domain-containing protein -
  FE321_RS09355 - 1359798..1359923 (-) 126 WP_280115905.1 hypothetical protein -
  FE321_RS06395 (FE321_06375) - 1359920..1360174 (-) 255 WP_208954925.1 hypothetical protein -
  FE321_RS06400 (FE321_06380) - 1360174..1360524 (-) 351 WP_208954926.1 hypothetical protein -
  FE321_RS06405 (FE321_06385) - 1360514..1360714 (-) 201 WP_208954927.1 hypothetical protein -
  FE321_RS06410 (FE321_06390) - 1360729..1361454 (-) 726 WP_208954928.1 helix-turn-helix transcriptional regulator -
  FE321_RS06415 (FE321_06395) - 1361471..1361677 (-) 207 WP_208954929.1 hypothetical protein -
  FE321_RS06420 (FE321_06400) - 1361670..1361927 (-) 258 WP_208954930.1 hypothetical protein -
  FE321_RS06425 (FE321_06405) - 1361908..1362105 (-) 198 WP_208954931.1 hypothetical protein -
  FE321_RS06430 (FE321_06410) - 1362196..1363020 (-) 825 WP_208954932.1 ATP-binding protein -
  FE321_RS06435 (FE321_06415) - 1362998..1363819 (-) 822 WP_208954933.1 DnaD domain protein -
  FE321_RS06440 (FE321_06420) ssbA 1363835..1364272 (-) 438 WP_208954934.1 single-stranded DNA-binding protein Machinery gene
  FE321_RS06445 (FE321_06425) - 1364273..1364938 (-) 666 WP_208954935.1 putative HNHc nuclease -
  FE321_RS06450 (FE321_06430) - 1365004..1365186 (-) 183 WP_208954936.1 hypothetical protein -
  FE321_RS06455 - 1365197..1365361 (-) 165 WP_181503559.1 hypothetical protein -
  FE321_RS06460 (FE321_06435) - 1365375..1365611 (-) 237 WP_111974365.1 hypothetical protein -
  FE321_RS06465 (FE321_06440) - 1365627..1365842 (-) 216 WP_208954937.1 helix-turn-helix transcriptional regulator -
  FE321_RS06470 (FE321_06445) - 1365917..1366705 (+) 789 WP_208954938.1 DUF4393 domain-containing protein -
  FE321_RS06475 (FE321_06450) - 1366740..1366928 (-) 189 WP_208954939.1 hypothetical protein -
  FE321_RS06480 (FE321_06455) - 1367031..1367690 (+) 660 WP_208954940.1 hypothetical protein -
  FE321_RS06485 (FE321_06460) - 1368017..1368598 (+) 582 WP_208954941.1 hypothetical protein -
  FE321_RS06490 (FE321_06465) - 1368692..1368895 (-) 204 WP_341874077.1 helix-turn-helix transcriptional regulator -
  FE321_RS09360 - 1369061..1369186 (-) 126 WP_280115587.1 hypothetical protein -
  FE321_RS06495 (FE321_06470) - 1369326..1370030 (+) 705 WP_208954943.1 XRE family transcriptional regulator -
  FE321_RS06500 (FE321_06475) - 1370106..1371146 (+) 1041 WP_244359444.1 Abi family protein -
  FE321_RS06505 (FE321_06480) - 1371261..1372355 (+) 1095 WP_208954944.1 site-specific integrase -

Sequence

Protein


Download         Length: 145 a.a.        Molecular weight: 16443.04 Da        Isoelectric Point: 4.7672

>NTDB_id=364261 FE321_RS06440 WP_208954934.1 1363835..1364272(-) (ssbA) [Dolosigranulum pigrum strain KPL3033]
MGLNQVTLVGRLTKDIELKYTNNGTAVTRFTLAVNRNYKNKQGEYDADFIVCQAWSKTAEFLSNHGSKGGRLGVVGRIQT
RNYEDQNGNRVYVTEVVTDQVDMIDWANDKKTDENKAANRHNPQPNTDDPFQNDTIDIDDNDLPF

Nucleotide


Download         Length: 438 bp        

>NTDB_id=364261 FE321_RS06440 WP_208954934.1 1363835..1364272(-) (ssbA) [Dolosigranulum pigrum strain KPL3033]
ATGGGATTAAACCAGGTAACATTAGTGGGCCGATTGACGAAAGATATTGAATTGAAATATACGAATAATGGGACAGCCGT
GACAAGATTTACCTTGGCAGTGAACCGTAATTATAAAAATAAACAAGGTGAATATGATGCCGATTTTATTGTGTGTCAGG
CGTGGAGCAAGACGGCGGAGTTTTTGTCCAATCATGGCAGTAAGGGTGGTCGTCTTGGGGTAGTTGGGCGTATTCAAACA
CGGAATTATGAGGATCAGAATGGTAATCGTGTCTATGTGACGGAAGTTGTGACGGATCAGGTGGATATGATTGATTGGGC
GAATGATAAGAAGACGGATGAGAATAAAGCAGCTAACCGTCATAATCCGCAACCAAACACAGATGATCCTTTCCAGAATG
ACACGATTGATATTGACGATAACGACTTACCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

45.614

100

0.538
  ssb Latilactobacillus sakei subsp. sakei 23K

41.42

100

0.483
  ssbB Bacillus subtilis subsp. subtilis str. 168

55.34

71.034

0.393

Multiple sequence alignment