Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FAZ25_RS00105 | Genome accession | NZ_CP039736 |
| Coordinates | 14676..15125 (-) | Length | 149 a.a. |
| NCBI ID | WP_192269683.1 | Uniprot ID | A0A7L8UWQ2 |
| Organism | Leuconostoc sp. LN180020 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 31..32909 | 14676..15125 | within | 0 |
Gene organization within MGE regions
Location: 31..32909
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FAZ25_RS00010 (FAZ25_00010) | - | 31..453 (-) | 423 | WP_192269637.1 | HK97 gp10 family phage protein | - |
| FAZ25_RS00015 (FAZ25_00015) | - | 453..788 (-) | 336 | WP_192269639.1 | phage head closure protein | - |
| FAZ25_RS00020 (FAZ25_00020) | - | 769..1107 (-) | 339 | WP_192269642.1 | head-tail connector protein | - |
| FAZ25_RS00025 (FAZ25_00025) | - | 1169..2374 (-) | 1206 | WP_192269645.1 | phage major capsid protein | - |
| FAZ25_RS00030 (FAZ25_00030) | - | 2375..3097 (-) | 723 | WP_243236218.1 | head maturation protease, ClpP-related | - |
| FAZ25_RS00035 (FAZ25_00035) | - | 3084..4250 (-) | 1167 | WP_192269648.1 | phage portal protein | - |
| FAZ25_RS00040 (FAZ25_00040) | - | 4251..4439 (-) | 189 | WP_155280002.1 | DUF1056 family protein | - |
| FAZ25_RS00045 (FAZ25_00045) | - | 4429..6312 (-) | 1884 | WP_192269651.1 | terminase large subunit | - |
| FAZ25_RS00050 (FAZ25_00050) | - | 6305..6700 (-) | 396 | WP_192269654.1 | phage terminase small subunit P27 family | - |
| FAZ25_RS00055 (FAZ25_00055) | - | 6941..7426 (-) | 486 | WP_192269657.1 | HNH endonuclease | - |
| FAZ25_RS00060 (FAZ25_00065) | - | 7711..8229 (-) | 519 | WP_192269660.1 | hypothetical protein | - |
| FAZ25_RS00065 (FAZ25_00070) | - | 8263..8505 (-) | 243 | WP_192269662.1 | hypothetical protein | - |
| FAZ25_RS00070 (FAZ25_00075) | - | 8563..9969 (-) | 1407 | WP_192269665.1 | FRG domain-containing protein | - |
| FAZ25_RS00075 (FAZ25_00080) | - | 9962..10531 (-) | 570 | WP_192269668.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FAZ25_RS00080 (FAZ25_00085) | - | 11814..12392 (-) | 579 | WP_192269670.1 | hypothetical protein | - |
| FAZ25_RS00085 (FAZ25_00090) | - | 12515..12934 (-) | 420 | WP_192269672.1 | DUF722 domain-containing protein | - |
| FAZ25_RS00090 (FAZ25_00095) | - | 13068..13430 (-) | 363 | WP_192269675.1 | YopX family protein | - |
| FAZ25_RS00095 (FAZ25_00100) | - | 13568..13972 (-) | 405 | WP_192269678.1 | dTDP-glucose pyrophosphorylase | - |
| FAZ25_RS00100 (FAZ25_00105) | - | 13981..14664 (-) | 684 | WP_192269681.1 | putative HNHc nuclease | - |
| FAZ25_RS00105 (FAZ25_00110) | ssb | 14676..15125 (-) | 450 | WP_192269683.1 | single-stranded DNA-binding protein | Machinery gene |
| FAZ25_RS00110 (FAZ25_00115) | - | 15112..15735 (-) | 624 | WP_192269685.1 | ERF family protein | - |
| FAZ25_RS00115 (FAZ25_00120) | - | 15732..16643 (-) | 912 | WP_192269688.1 | DUF1351 domain-containing protein | - |
| FAZ25_RS00120 (FAZ25_00125) | - | 16729..16995 (-) | 267 | WP_192269690.1 | hypothetical protein | - |
| FAZ25_RS00125 (FAZ25_00130) | - | 16999..17787 (-) | 789 | WP_243236219.1 | conserved phage C-terminal domain-containing protein | - |
| FAZ25_RS00130 | - | 17803..18006 (-) | 204 | WP_192269861.1 | hypothetical protein | - |
| FAZ25_RS00135 (FAZ25_00135) | - | 17972..18169 (-) | 198 | WP_192269692.1 | hypothetical protein | - |
| FAZ25_RS00140 | - | 18159..18329 (-) | 171 | WP_192269693.1 | hypothetical protein | - |
| FAZ25_RS00145 (FAZ25_00140) | - | 18488..19162 (+) | 675 | WP_192269695.1 | hypothetical protein | - |
| FAZ25_RS00150 (FAZ25_00145) | - | 19188..19385 (-) | 198 | WP_192269696.1 | hypothetical protein | - |
| FAZ25_RS00155 (FAZ25_00150) | - | 19395..19628 (-) | 234 | WP_192269698.1 | hypothetical protein | - |
| FAZ25_RS00160 (FAZ25_00155) | - | 19640..20431 (-) | 792 | WP_192269699.1 | phage antirepressor KilAC domain-containing protein | - |
| FAZ25_RS00165 (FAZ25_00160) | - | 20442..20645 (-) | 204 | WP_004900871.1 | helix-turn-helix transcriptional regulator | - |
| FAZ25_RS00170 (FAZ25_00165) | - | 20895..21242 (+) | 348 | WP_192269701.1 | helix-turn-helix domain-containing protein | - |
| FAZ25_RS00175 (FAZ25_00170) | - | 21239..21673 (+) | 435 | WP_192269702.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FAZ25_RS00180 (FAZ25_00175) | - | 21714..22415 (+) | 702 | WP_192269704.1 | potassium channel family protein | - |
| FAZ25_RS00185 (FAZ25_00180) | - | 22743..23810 (+) | 1068 | WP_192269706.1 | site-specific integrase | - |
| FAZ25_RS00190 (FAZ25_00185) | - | 24207..26003 (+) | 1797 | WP_048801566.1 | ABC transporter ATP-binding protein | - |
| FAZ25_RS00195 (FAZ25_00190) | - | 26020..26253 (+) | 234 | WP_243236220.1 | hypothetical protein | - |
| FAZ25_RS00200 (FAZ25_00195) | pta | 26282..27274 (-) | 993 | WP_012305091.1 | phosphate acetyltransferase | - |
| FAZ25_RS00205 (FAZ25_00200) | - | 27363..28022 (-) | 660 | WP_192269710.1 | uracil-DNA glycosylase | - |
| FAZ25_RS00210 (FAZ25_00205) | - | 28065..28604 (+) | 540 | WP_004900403.1 | LURP-one-related/scramblase family protein | - |
| FAZ25_RS00215 (FAZ25_00210) | mmuM | 28696..29610 (-) | 915 | WP_100665384.1 | homocysteine S-methyltransferase | - |
| FAZ25_RS00220 (FAZ25_00215) | - | 29597..31009 (-) | 1413 | WP_192269712.1 | amino acid permease | - |
| FAZ25_RS00225 (FAZ25_00220) | - | 31399..32127 (-) | 729 | WP_004900410.1 | ABC transporter ATP-binding protein | - |
| FAZ25_RS00230 (FAZ25_00225) | - | 32124..32909 (-) | 786 | WP_192269714.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16499.22 Da Isoelectric Point: 5.2048
>NTDB_id=360563 FAZ25_RS00105 WP_192269683.1 14676..15125(-) (ssb) [Leuconostoc sp. LN180020]
MNQVNLIGRLSKDIDVRYTQSGKAVGSGSIAVNRRFRSANGERQADFINFVIWDKAAENLANFTHKGSQVGLGGEWQTRN
YENNNGQKIYVNELLVSNFDLLEPKAAKQTQSNLDSMDPFAGQNTKQSPNPFAASAKTEIDISDDDLPF
MNQVNLIGRLSKDIDVRYTQSGKAVGSGSIAVNRRFRSANGERQADFINFVIWDKAAENLANFTHKGSQVGLGGEWQTRN
YENNNGQKIYVNELLVSNFDLLEPKAAKQTQSNLDSMDPFAGQNTKQSPNPFAASAKTEIDISDDDLPF
Nucleotide
Download Length: 450 bp
>NTDB_id=360563 FAZ25_RS00105 WP_192269683.1 14676..15125(-) (ssb) [Leuconostoc sp. LN180020]
ATGAACCAGGTTAATTTAATCGGCCGTTTATCAAAGGATATAGACGTTAGATATACACAATCAGGAAAAGCAGTTGGAAG
TGGTTCAATCGCAGTTAATCGCCGCTTTAGAAGTGCTAATGGTGAGCGCCAAGCTGACTTTATCAACTTTGTTATCTGGG
ACAAGGCGGCTGAAAACCTAGCTAATTTCACACACAAAGGCTCACAGGTTGGGCTAGGTGGCGAGTGGCAAACGCGCAAC
TATGAAAACAACAATGGCCAAAAAATCTATGTGAATGAGTTGTTAGTTAGTAACTTTGATTTATTAGAGCCAAAAGCTGC
GAAACAGACACAAAGCAATTTAGACAGCATGGATCCATTCGCTGGACAAAACACAAAGCAGTCACCTAATCCTTTTGCAG
CATCAGCAAAAACAGAAATTGACATTTCAGATGATGACTTGCCATTCTGA
ATGAACCAGGTTAATTTAATCGGCCGTTTATCAAAGGATATAGACGTTAGATATACACAATCAGGAAAAGCAGTTGGAAG
TGGTTCAATCGCAGTTAATCGCCGCTTTAGAAGTGCTAATGGTGAGCGCCAAGCTGACTTTATCAACTTTGTTATCTGGG
ACAAGGCGGCTGAAAACCTAGCTAATTTCACACACAAAGGCTCACAGGTTGGGCTAGGTGGCGAGTGGCAAACGCGCAAC
TATGAAAACAACAATGGCCAAAAAATCTATGTGAATGAGTTGTTAGTTAGTAACTTTGATTTATTAGAGCCAAAAGCTGC
GAAACAGACACAAAGCAATTTAGACAGCATGGATCCATTCGCTGGACAAAACACAAAGCAGTCACCTAATCCTTTTGCAG
CATCAGCAAAAACAGAAATTGACATTTCAGATGATGACTTGCCATTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.577 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.605 |
100 |
0.503 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.541 |
99.329 |
0.403 |