Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BAMTA208_RS12205 Genome accession   NC_017188
Coordinates   2424707..2425021 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens TA208     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2419707..2430021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMTA208_RS12160 (BAMTA208_12645) sinI 2420391..2420564 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  BAMTA208_RS12165 (BAMTA208_12650) sinR 2420598..2420933 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  BAMTA208_RS12170 (BAMTA208_12655) tasA 2420981..2421766 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  BAMTA208_RS12175 (BAMTA208_12660) sipW 2421831..2422415 (-) 585 WP_013352863.1 signal peptidase I SipW -
  BAMTA208_RS12180 (BAMTA208_12665) tapA 2422387..2423058 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  BAMTA208_RS12185 (BAMTA208_12670) - 2423316..2423645 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  BAMTA208_RS12190 (BAMTA208_12675) - 2423686..2423865 (-) 180 WP_013352866.1 YqzE family protein -
  BAMTA208_RS12195 (BAMTA208_12680) comGG 2423919..2424296 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMTA208_RS12200 (BAMTA208_12685) comGF 2424298..2424798 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF Machinery gene
  BAMTA208_RS12205 (BAMTA208_12690) comGE 2424707..2425021 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMTA208_RS12210 (BAMTA208_12695) comGD 2425005..2425442 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAMTA208_RS12215 (BAMTA208_12700) comGC 2425432..2425698 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  BAMTA208_RS12220 (BAMTA208_12705) comGB 2425745..2426782 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAMTA208_RS12225 (BAMTA208_12710) comGA 2426769..2427839 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  BAMTA208_RS12230 (BAMTA208_12715) - 2428033..2428983 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=35554 BAMTA208_RS12205 WP_014470662.1 2424707..2425021(-) (comGE) [Bacillus amyloliquefaciens TA208]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=35554 BAMTA208_RS12205 WP_014470662.1 2424707..2425021(-) (comGE) [Bacillus amyloliquefaciens TA208]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment