Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SaO268_RS01525 | Genome accession | NZ_CP038612 |
| Coordinates | 328862..329281 (+) | Length | 139 a.a. |
| NCBI ID | WP_000934796.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O268 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 321211..366262 | 328862..329281 | within | 0 |
Gene organization within MGE regions
Location: 321211..366262
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO268_RS01445 (SaO268_0267) | - | 321211..322416 (-) | 1206 | WP_000264756.1 | tyrosine-type recombinase/integrase | - |
| SaO268_RS01450 (SaO268_0268) | - | 322519..323169 (-) | 651 | WP_001108426.1 | type II CAAX endopeptidase family protein | - |
| SaO268_RS14935 | - | 323312..323596 (-) | 285 | Protein_275 | toxin | - |
| SaO268_RS01460 (SaO268_0269) | - | 323642..324076 (-) | 435 | WP_000755716.1 | hypothetical protein | - |
| SaO268_RS01465 (SaO268_0270) | - | 324094..324555 (-) | 462 | WP_000524999.1 | hypothetical protein | - |
| SaO268_RS01470 (SaO268_0271) | - | 324568..324897 (-) | 330 | WP_000429766.1 | helix-turn-helix transcriptional regulator | - |
| SaO268_RS01475 (SaO268_0272) | - | 325058..325249 (+) | 192 | WP_001115060.1 | helix-turn-helix transcriptional regulator | - |
| SaO268_RS14780 (SaO268_0273) | - | 325337..325513 (+) | 177 | WP_001001356.1 | hypothetical protein | - |
| SaO268_RS01480 (SaO268_0274) | - | 325510..325740 (-) | 231 | WP_000549547.1 | hypothetical protein | - |
| SaO268_RS01485 (SaO268_0275) | - | 325797..326549 (+) | 753 | WP_001148596.1 | phage antirepressor KilAC domain-containing protein | - |
| SaO268_RS01490 (SaO268_0276) | - | 326565..326762 (+) | 198 | WP_001202628.1 | hypothetical protein | - |
| SaO268_RS14940 | - | 326774..326905 (+) | 132 | Protein_284 | MW1434 family type I TA system toxin | - |
| SaO268_RS01495 (SaO268_0277) | - | 326908..327171 (+) | 264 | WP_001124184.1 | helix-turn-helix domain-containing protein | - |
| SaO268_RS01500 (SaO268_0278) | - | 327184..327345 (+) | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| SaO268_RS01505 (SaO268_0279) | - | 327448..327750 (+) | 303 | WP_000165372.1 | DUF2482 family protein | - |
| SaO268_RS01510 (SaO268_0280) | - | 327755..328015 (+) | 261 | WP_000291499.1 | DUF1108 family protein | - |
| SaO268_RS01515 (SaO268_0281) | - | 328025..328246 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| SaO268_RS01520 (SaO268_0282) | - | 328239..328862 (+) | 624 | WP_000139727.1 | DUF1071 domain-containing protein | - |
| SaO268_RS01525 (SaO268_0283) | ssbA | 328862..329281 (+) | 420 | WP_000934796.1 | single-stranded DNA-binding protein | Machinery gene |
| SaO268_RS01530 (SaO268_0284) | - | 329295..329990 (+) | 696 | WP_135830941.1 | putative HNHc nuclease | - |
| SaO268_RS01535 (SaO268_0285) | - | 329962..330762 (+) | 801 | WP_135830942.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SaO268_RS14785 (SaO268_0286) | - | 330762..331112 (+) | 351 | Protein_294 | hypothetical protein | - |
| SaO268_RS01540 (SaO268_0287) | - | 331089..332010 (+) | 922 | Protein_295 | DnaB helicase C-terminal domain-containing protein | - |
| SaO268_RS01545 (SaO268_0288) | - | 332007..332222 (+) | 216 | WP_001024404.1 | hypothetical protein | - |
| SaO268_RS01550 (SaO268_0289) | - | 332225..332446 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SaO268_RS01555 (SaO268_0290) | - | 332457..332861 (+) | 405 | WP_000049813.1 | DUF1064 domain-containing protein | - |
| SaO268_RS01560 (SaO268_0291) | - | 332866..333051 (+) | 186 | WP_065315894.1 | DUF3113 family protein | - |
| SaO268_RS01565 (SaO268_0292) | - | 333052..333320 (+) | 269 | Protein_300 | helix-turn-helix transcriptional regulator | - |
| SaO268_RS01570 (SaO268_0293) | - | 333321..333692 (+) | 372 | WP_001140276.1 | SA1788 family PVL leukocidin-associated protein | - |
| SaO268_RS01575 (SaO268_0294) | - | 333693..333941 (+) | 249 | WP_001124144.1 | phi PVL orf 51-like protein | - |
| SaO268_RS01580 (SaO268_0295) | - | 333955..334161 (+) | 207 | WP_000693996.1 | hypothetical protein | - |
| SaO268_RS01585 (SaO268_0296) | - | 334164..334574 (+) | 411 | WP_000695751.1 | DUF4388 domain-containing protein | - |
| SaO268_RS01590 (SaO268_0297) | - | 334574..334849 (+) | 276 | WP_000399884.1 | hypothetical protein | - |
| SaO268_RS01595 (SaO268_0298) | - | 334842..335090 (+) | 249 | WP_001065080.1 | DUF1024 family protein | - |
| SaO268_RS01600 (SaO268_0299) | - | 335083..335619 (+) | 537 | WP_000185699.1 | dUTPase | - |
| SaO268_RS01605 (SaO268_0300) | - | 335656..335940 (+) | 285 | WP_000154474.1 | hypothetical protein | - |
| SaO268_RS01615 (SaO268_0302) | - | 336160..336366 (+) | 207 | WP_000195824.1 | DUF1381 domain-containing protein | - |
| SaO268_RS01620 (SaO268_0303) | - | 336363..336515 (+) | 153 | WP_000595213.1 | transcriptional activator RinB | - |
| SaO268_RS01625 (SaO268_0304) | - | 336583..336783 (+) | 201 | WP_000265259.1 | DUF1514 family protein | - |
| SaO268_RS14880 (SaO268_0305) | - | 336832..339279 (+) | 2448 | WP_000884863.1 | virulence-associated E family protein | - |
| SaO268_RS01635 | - | 339388..339486 (-) | 99 | WP_078061081.1 | hypothetical protein | - |
| SaO268_RS01640 (SaO268_0306) | - | 339620..339910 (+) | 291 | WP_000665203.1 | VRR-NUC domain-containing protein | - |
| SaO268_RS01645 (SaO268_0307) | - | 339891..341258 (+) | 1368 | WP_014532555.1 | DEAD/DEAH box helicase | - |
| SaO268_RS01650 (SaO268_0308) | - | 341271..341708 (+) | 438 | WP_000535920.1 | transcriptional regulator | - |
| SaO268_RS01655 (SaO268_0309) | - | 341865..342179 (+) | 315 | WP_000160694.1 | HNH endonuclease | - |
| SaO268_RS01660 (SaO268_0310) | - | 342307..342612 (+) | 306 | WP_000778933.1 | P27 family phage terminase small subunit | - |
| SaO268_RS01665 (SaO268_0311) | - | 342602..344293 (+) | 1692 | WP_000153546.1 | terminase TerL endonuclease subunit | - |
| SaO268_RS01670 (SaO268_0312) | - | 344298..345536 (+) | 1239 | WP_065315609.1 | phage portal protein | - |
| SaO268_RS01675 (SaO268_0313) | - | 345520..346293 (+) | 774 | WP_000036980.1 | head maturation protease, ClpP-related | - |
| SaO268_RS01680 (SaO268_0314) | - | 346305..347468 (+) | 1164 | WP_001142731.1 | phage major capsid protein | - |
| SaO268_RS01685 (SaO268_0315) | - | 347537..347815 (+) | 279 | WP_000050976.1 | head-tail connector protein | - |
| SaO268_RS01690 (SaO268_0316) | - | 347827..348159 (+) | 333 | WP_000395496.1 | hypothetical protein | - |
| SaO268_RS01695 (SaO268_0317) | - | 348156..348557 (+) | 402 | WP_000110017.1 | hypothetical protein | - |
| SaO268_RS01700 (SaO268_0318) | - | 348558..348953 (+) | 396 | WP_001023807.1 | DUF3168 domain-containing protein | - |
| SaO268_RS01705 (SaO268_0319) | - | 348988..349629 (+) | 642 | WP_000807538.1 | major tail protein | - |
| SaO268_RS01710 (SaO268_0320) | - | 349721..350176 (+) | 456 | WP_000169134.1 | Ig-like domain-containing protein | - |
| SaO268_RS01715 (SaO268_0321) | - | 350203..350553 (+) | 351 | WP_000589167.1 | hypothetical protein | - |
| SaO268_RS01720 (SaO268_0322) | - | 350595..350753 (+) | 159 | WP_000438833.1 | hypothetical protein | - |
| SaO268_RS01725 (SaO268_0323) | - | 350767..356966 (+) | 6200 | Protein_331 | phage tail tape measure protein | - |
| SaO268_RS01730 (SaO268_0324) | - | 356966..357790 (+) | 825 | WP_001190535.1 | phage tail family protein | - |
| SaO268_RS01735 (SaO268_0325) | - | 357799..359382 (+) | 1584 | WP_000384457.1 | prophage endopeptidase tail family protein | - |
| SaO268_RS01740 (SaO268_0326) | - | 359382..359672 (+) | 291 | WP_000179860.1 | hypothetical protein | - |
| SaO268_RS01745 (SaO268_0327) | - | 359688..361598 (+) | 1911 | WP_000429563.1 | hypothetical protein | - |
| SaO268_RS01750 (SaO268_0328) | - | 361598..363064 (+) | 1467 | WP_000067157.1 | BppU family phage baseplate upper protein | - |
| SaO268_RS01755 (SaO268_0329) | - | 363064..363453 (+) | 390 | WP_001166604.1 | DUF2977 domain-containing protein | - |
| SaO268_RS01760 (SaO268_0330) | - | 363446..363610 (+) | 165 | WP_000916020.1 | XkdX family protein | - |
| SaO268_RS01765 (SaO268_0331) | - | 363656..363955 (+) | 300 | WP_000466773.1 | DUF2951 family protein | - |
| SaO268_RS14945 | - | 364189..364296 (+) | 108 | WP_000255429.1 | putative holin-like toxin | - |
| SaO268_RS01775 | - | 364343..364443 (-) | 101 | Protein_341 | hypothetical protein | - |
| SaO268_RS01780 (SaO268_0332) | - | 364494..364796 (+) | 303 | WP_000448764.1 | phage holin | - |
| SaO268_RS01785 (SaO268_0333) | - | 364808..366262 (+) | 1455 | WP_000930278.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15606.24 Da Isoelectric Point: 7.0171
>NTDB_id=355168 SaO268_RS01525 WP_000934796.1 328862..329281(+) (ssbA) [Staphylococcus aureus strain O268]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=355168 SaO268_RS01525 WP_000934796.1 328862..329281(+) (ssbA) [Staphylococcus aureus strain O268]
ATGTTAAACAGAGTAGTTTTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTTCAATTCTTAGAACCGAAGAA
TAACAACAAACAGAATAACCAACAACACAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACT
TTTCTGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTTCAATTCTTAGAACCGAAGAA
TAACAACAAACAGAATAACCAACAACACAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACT
TTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
76.978 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.947 |
100 |
0.59 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.091 |
79.137 |
0.468 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.288 |
100 |
0.403 |
| ssbA | Streptococcus mutans UA159 |
45.378 |
85.612 |
0.388 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.057 |
76.259 |
0.374 |