Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | E3U39_RS17585 | Genome accession | NZ_CP038028 |
| Coordinates | 3475586..3475759 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain FS1092 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3470586..3480759
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3U39_RS17535 (E3U39_17535) | comGD | 3470706..3471143 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| E3U39_RS17540 (E3U39_17540) | comGE | 3471127..3471441 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| E3U39_RS17545 (E3U39_17545) | comGF | 3471350..3471850 (+) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| E3U39_RS17550 (E3U39_17550) | comGG | 3471851..3472228 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| E3U39_RS17555 (E3U39_17555) | - | 3472285..3472464 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| E3U39_RS17560 (E3U39_17560) | - | 3472504..3472833 (-) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| E3U39_RS17565 (E3U39_17565) | tapA | 3473092..3473763 (+) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| E3U39_RS17570 (E3U39_17570) | - | 3473735..3474319 (+) | 585 | WP_015240205.1 | signal peptidase I | - |
| E3U39_RS17575 (E3U39_17575) | - | 3474384..3475169 (+) | 786 | WP_007408329.1 | TasA family protein | - |
| E3U39_RS17580 (E3U39_17580) | sinR | 3475217..3475552 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| E3U39_RS17585 (E3U39_17585) | sinI | 3475586..3475759 (-) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| E3U39_RS17590 (E3U39_17590) | - | 3475936..3476730 (-) | 795 | WP_007408330.1 | YqhG family protein | - |
| E3U39_RS17595 (E3U39_17595) | - | 3476752..3478422 (-) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| E3U39_RS17600 (E3U39_17600) | gcvT | 3478846..3479946 (+) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=351625 E3U39_RS17585 WP_003153105.1 3475586..3475759(-) (sinI) [Bacillus amyloliquefaciens strain FS1092]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=351625 E3U39_RS17585 WP_003153105.1 3475586..3475759(-) (sinI) [Bacillus amyloliquefaciens strain FS1092]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |