Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   E3U39_RS17550 Genome accession   NZ_CP038028
Coordinates   3471851..3472228 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain FS1092     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3466851..3477228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3U39_RS17515 (E3U39_17515) - 3467166..3468116 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  E3U39_RS17520 (E3U39_17520) comGA 3468309..3469379 (+) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  E3U39_RS17525 (E3U39_17525) comGB 3469366..3470403 (+) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  E3U39_RS17530 (E3U39_17530) comGC 3470408..3470716 (+) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  E3U39_RS17535 (E3U39_17535) comGD 3470706..3471143 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  E3U39_RS17540 (E3U39_17540) comGE 3471127..3471441 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  E3U39_RS17545 (E3U39_17545) comGF 3471350..3471850 (+) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  E3U39_RS17550 (E3U39_17550) comGG 3471851..3472228 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  E3U39_RS17555 (E3U39_17555) - 3472285..3472464 (+) 180 WP_003153093.1 YqzE family protein -
  E3U39_RS17560 (E3U39_17560) - 3472504..3472833 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  E3U39_RS17565 (E3U39_17565) tapA 3473092..3473763 (+) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  E3U39_RS17570 (E3U39_17570) - 3473735..3474319 (+) 585 WP_015240205.1 signal peptidase I -
  E3U39_RS17575 (E3U39_17575) - 3474384..3475169 (+) 786 WP_007408329.1 TasA family protein -
  E3U39_RS17580 (E3U39_17580) sinR 3475217..3475552 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  E3U39_RS17585 (E3U39_17585) sinI 3475586..3475759 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  E3U39_RS17590 (E3U39_17590) - 3475936..3476730 (-) 795 WP_007408330.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=351623 E3U39_RS17550 WP_015417814.1 3471851..3472228(+) (comGG) [Bacillus amyloliquefaciens strain FS1092]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=351623 E3U39_RS17550 WP_015417814.1 3471851..3472228(+) (comGG) [Bacillus amyloliquefaciens strain FS1092]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment