Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   E3U39_RS14070 Genome accession   NZ_CP038028
Coordinates   2833003..2833173 (+) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain FS1092     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2828003..2838173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E3U39_RS14040 (E3U39_14040) - 2828153..2829619 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  E3U39_RS14045 (E3U39_14045) - 2829749..2830972 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  E3U39_RS14050 (E3U39_14050) - 2830979..2831320 (-) 342 WP_007408677.1 hypothetical protein -
  E3U39_RS14060 (E3U39_14060) degQ 2831783..2831923 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  E3U39_RS14065 (E3U39_14065) comQ 2832054..2833040 (+) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  E3U39_RS14070 (E3U39_14070) comX 2833003..2833173 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  E3U39_RS14075 (E3U39_14075) comP 2833193..2835496 (+) 2304 WP_134482467.1 histidine kinase Regulator
  E3U39_RS14080 (E3U39_14080) comA 2835577..2836221 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  E3U39_RS14085 (E3U39_14085) - 2836243..2836626 (+) 384 WP_053574130.1 hotdog fold thioesterase -
  E3U39_RS14090 (E3U39_14090) mnhG 2836666..2837040 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  E3U39_RS14095 (E3U39_14095) - 2837024..2837308 (-) 285 WP_012118311.1 Na(+)/H(+) antiporter subunit F1 -
  E3U39_RS14100 (E3U39_14100) - 2837308..2837784 (-) 477 WP_007613428.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=351604 E3U39_RS14070 WP_003152048.1 2833003..2833173(+) (comX) [Bacillus amyloliquefaciens strain FS1092]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=351604 E3U39_RS14070 WP_003152048.1 2833003..2833173(+) (comX) [Bacillus amyloliquefaciens strain FS1092]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACCCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5

Multiple sequence alignment