Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | E3U39_RS14060 | Genome accession | NZ_CP038028 |
| Coordinates | 2831783..2831923 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain FS1092 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2826783..2836923
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3U39_RS14030 (E3U39_14030) | - | 2827089..2827487 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| E3U39_RS14035 (E3U39_14035) | - | 2827584..2828135 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| E3U39_RS14040 (E3U39_14040) | - | 2828153..2829619 (+) | 1467 | WP_015418109.1 | nicotinate phosphoribosyltransferase | - |
| E3U39_RS14045 (E3U39_14045) | - | 2829749..2830972 (+) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| E3U39_RS14050 (E3U39_14050) | - | 2830979..2831320 (-) | 342 | WP_007408677.1 | hypothetical protein | - |
| E3U39_RS14060 (E3U39_14060) | degQ | 2831783..2831923 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| E3U39_RS14065 (E3U39_14065) | comQ | 2832054..2833040 (+) | 987 | WP_269195024.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| E3U39_RS14070 (E3U39_14070) | comX | 2833003..2833173 (+) | 171 | WP_003152048.1 | competence pheromone ComX | Regulator |
| E3U39_RS14075 (E3U39_14075) | comP | 2833193..2835496 (+) | 2304 | WP_134482467.1 | histidine kinase | Regulator |
| E3U39_RS14080 (E3U39_14080) | comA | 2835577..2836221 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| E3U39_RS14085 (E3U39_14085) | - | 2836243..2836626 (+) | 384 | WP_053574130.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=351602 E3U39_RS14060 WP_003152043.1 2831783..2831923(+) (degQ) [Bacillus amyloliquefaciens strain FS1092]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=351602 E3U39_RS14060 WP_003152043.1 2831783..2831923(+) (degQ) [Bacillus amyloliquefaciens strain FS1092]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |