Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   GL187_RS02510 Genome accession   NZ_CP046379
Coordinates   488651..488800 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 563     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 483651..493800
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GL187_RS02485 (GL187_02560) comA/nlmT 484718..486394 (-) 1677 WP_215729172.1 peptide cleavage/export ABC transporter Regulator
  GL187_RS11535 comA/nlmT 486288..486875 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  GL187_RS02495 (GL187_02565) blpI 487157..487354 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  GL187_RS02500 (GL187_02570) blpJ 487821..488090 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  GL187_RS02505 (GL187_02575) blpK 488159..488407 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  GL187_RS02510 (GL187_02580) cipB 488651..488800 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  GL187_RS02515 (GL187_02585) - 488904..489023 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  GL187_RS02520 (GL187_02595) - 489504..489862 (+) 359 Protein_502 immunity protein -
  GL187_RS02525 (GL187_02600) - 490491..490874 (+) 384 WP_000877381.1 hypothetical protein -
  GL187_RS02530 (GL187_02605) - 490926..491615 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  GL187_RS02535 (GL187_02610) blpZ 491657..491890 (+) 234 WP_000276498.1 immunity protein BlpZ -
  GL187_RS02540 (GL187_02615) - 492041..492652 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  GL187_RS02545 (GL187_02620) ccrZ 492813..493607 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=351445 GL187_RS02510 WP_001809846.1 488651..488800(+) (cipB) [Streptococcus pneumoniae strain 563]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=351445 GL187_RS02510 WP_001809846.1 488651..488800(+) (cipB) [Streptococcus pneumoniae strain 563]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531