Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   EYB46_RS18190 Genome accession   NZ_CP036518
Coordinates   3621887..3622264 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain ANSB01E     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3616887..3627264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYB46_RS18155 (EYB46_18150) - 3617197..3618147 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  EYB46_RS18160 (EYB46_18155) comGA 3618344..3619415 (+) 1072 Protein_3488 competence type IV pilus ATPase ComGA -
  EYB46_RS18165 (EYB46_18160) comGB 3619402..3620439 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  EYB46_RS18170 (EYB46_18165) comGC 3620486..3620752 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  EYB46_RS18175 (EYB46_18170) comGD 3620742..3621179 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  EYB46_RS18180 (EYB46_18175) comGE 3621163..3621477 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  EYB46_RS18185 (EYB46_18180) comGF 3621386..3621886 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  EYB46_RS18190 (EYB46_18185) comGG 3621887..3622264 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  EYB46_RS18195 (EYB46_18190) - 3622321..3622500 (+) 180 WP_022552966.1 YqzE family protein -
  EYB46_RS18200 (EYB46_18195) - 3622541..3622870 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  EYB46_RS18205 (EYB46_18200) tapA 3623129..3623800 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  EYB46_RS18210 (EYB46_18205) - 3623772..3624356 (+) 585 WP_032874025.1 signal peptidase I -
  EYB46_RS18215 (EYB46_18210) - 3624421..3625206 (+) 786 WP_032874027.1 TasA family protein -
  EYB46_RS18220 (EYB46_18215) sinR 3625254..3625589 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EYB46_RS18225 (EYB46_18220) sinI 3625623..3625796 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  EYB46_RS18230 (EYB46_18225) - 3625973..3626767 (-) 795 WP_007612541.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=349343 EYB46_RS18190 WP_032874019.1 3621887..3622264(+) (comGG) [Bacillus velezensis strain ANSB01E]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=349343 EYB46_RS18190 WP_032874019.1 3621887..3622264(+) (comGG) [Bacillus velezensis strain ANSB01E]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488


Multiple sequence alignment