Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EYB46_RS18225 Genome accession   NZ_CP036518
Coordinates   3625623..3625796 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain ANSB01E     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3620623..3630796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYB46_RS18175 (EYB46_18170) comGD 3620742..3621179 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  EYB46_RS18180 (EYB46_18175) comGE 3621163..3621477 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  EYB46_RS18185 (EYB46_18180) comGF 3621386..3621886 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  EYB46_RS18190 (EYB46_18185) comGG 3621887..3622264 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  EYB46_RS18195 (EYB46_18190) - 3622321..3622500 (+) 180 WP_022552966.1 YqzE family protein -
  EYB46_RS18200 (EYB46_18195) - 3622541..3622870 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  EYB46_RS18205 (EYB46_18200) tapA 3623129..3623800 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  EYB46_RS18210 (EYB46_18205) - 3623772..3624356 (+) 585 WP_032874025.1 signal peptidase I -
  EYB46_RS18215 (EYB46_18210) - 3624421..3625206 (+) 786 WP_032874027.1 TasA family protein -
  EYB46_RS18220 (EYB46_18215) sinR 3625254..3625589 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EYB46_RS18225 (EYB46_18220) sinI 3625623..3625796 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  EYB46_RS18230 (EYB46_18225) - 3625973..3626767 (-) 795 WP_007612541.1 YqhG family protein -
  EYB46_RS18235 (EYB46_18230) - 3626789..3628459 (-) 1671 WP_032874031.1 SNF2-related protein -
  EYB46_RS18240 (EYB46_18235) gcvT 3628882..3629982 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=349345 EYB46_RS18225 WP_032874029.1 3625623..3625796(-) (sinI) [Bacillus velezensis strain ANSB01E]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=349345 EYB46_RS18225 WP_032874029.1 3625623..3625796(-) (sinI) [Bacillus velezensis strain ANSB01E]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment