Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   EYB46_RS18170 Genome accession   NZ_CP036518
Coordinates   3620486..3620752 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain ANSB01E     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3615486..3625752
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYB46_RS18150 (EYB46_18145) - 3615750..3617051 (-) 1302 WP_032874010.1 hemolysin family protein -
  EYB46_RS18155 (EYB46_18150) - 3617197..3618147 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  EYB46_RS18160 (EYB46_18155) comGA 3618344..3619415 (+) 1072 Protein_3488 competence type IV pilus ATPase ComGA -
  EYB46_RS18165 (EYB46_18160) comGB 3619402..3620439 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  EYB46_RS18170 (EYB46_18165) comGC 3620486..3620752 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  EYB46_RS18175 (EYB46_18170) comGD 3620742..3621179 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  EYB46_RS18180 (EYB46_18175) comGE 3621163..3621477 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  EYB46_RS18185 (EYB46_18180) comGF 3621386..3621886 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  EYB46_RS18190 (EYB46_18185) comGG 3621887..3622264 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  EYB46_RS18195 (EYB46_18190) - 3622321..3622500 (+) 180 WP_022552966.1 YqzE family protein -
  EYB46_RS18200 (EYB46_18195) - 3622541..3622870 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  EYB46_RS18205 (EYB46_18200) tapA 3623129..3623800 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  EYB46_RS18210 (EYB46_18205) - 3623772..3624356 (+) 585 WP_032874025.1 signal peptidase I -
  EYB46_RS18215 (EYB46_18210) - 3624421..3625206 (+) 786 WP_032874027.1 TasA family protein -
  EYB46_RS18220 (EYB46_18215) sinR 3625254..3625589 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=349340 EYB46_RS18170 WP_042635730.1 3620486..3620752(+) (comGC) [Bacillus velezensis strain ANSB01E]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=349340 EYB46_RS18170 WP_042635730.1 3620486..3620752(+) (comGC) [Bacillus velezensis strain ANSB01E]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment