Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EYC13_RS04690 Genome accession   NZ_CP036395
Coordinates   977765..977890 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain 29A2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 972765..982890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYC13_RS04670 - 973466..974869 (-) 1404 WP_000694860.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  EYC13_RS04675 comB10 974934..976070 (-) 1137 WP_001045899.1 DNA type IV secretion system protein ComB10 Machinery gene
  EYC13_RS04680 comB9 976063..977025 (-) 963 WP_001987609.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EYC13_RS04685 comB8 977025..977768 (-) 744 WP_000660543.1 virB8 family protein Machinery gene
  EYC13_RS04690 comB7 977765..977890 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  EYC13_RS04695 comB6 977906..978961 (-) 1056 WP_000786643.1 P-type conjugative transfer protein TrbL Machinery gene
  EYC13_RS04700 - 978967..979962 (-) 996 WP_000468812.1 PDZ domain-containing protein -
  EYC13_RS04705 - 979962..980255 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  EYC13_RS04710 panD 980266..980616 (-) 351 WP_000142212.1 aspartate 1-decarboxylase -
  EYC13_RS04715 - 980606..982828 (-) 2223 WP_001051530.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=348680 EYC13_RS04690 WP_001217874.1 977765..977890(-) (comB7) [Helicobacter pylori strain 29A2]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=348680 EYC13_RS04690 WP_001217874.1 977765..977890(-) (comB7) [Helicobacter pylori strain 29A2]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment