Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII83_RS16185 Genome accession   NZ_CP045818
Coordinates   3126219..3126359 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MB9_B6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3121219..3131359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII83_RS16160 (GII83_16160) yuxO 3121569..3121949 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII83_RS16165 (GII83_16165) comA 3121968..3122612 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII83_RS16170 (GII83_16170) comP 3122693..3124990 (-) 2298 WP_153912412.1 histidine kinase Regulator
  GII83_RS16175 (GII83_16175) comX 3124998..3125159 (-) 162 WP_049140565.1 competence pheromone ComX -
  GII83_RS16180 (GII83_16180) comQ 3125174..3126034 (-) 861 WP_040081966.1 polyprenyl synthetase family protein Regulator
  GII83_RS16185 (GII83_16185) degQ 3126219..3126359 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII83_RS21320 - 3126581..3126643 (+) 63 Protein_3148 hypothetical protein -
  GII83_RS16190 (GII83_16190) - 3126821..3127189 (+) 369 WP_017695529.1 hypothetical protein -
  GII83_RS16195 (GII83_16195) pdeH 3127165..3128394 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII83_RS16200 (GII83_16200) pncB 3128531..3130003 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII83_RS16205 (GII83_16205) pncA 3130019..3130570 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  GII83_RS16210 (GII83_16210) yueI 3130667..3131065 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=347002 GII83_RS16185 WP_003220708.1 3126219..3126359(-) (degQ) [Bacillus subtilis strain MB9_B6]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=347002 GII83_RS16185 WP_003220708.1 3126219..3126359(-) (degQ) [Bacillus subtilis strain MB9_B6]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment