Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EU243_RS11945 | Genome accession | NZ_CP035533 |
| Coordinates | 2325262..2325435 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain DTU001 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2320262..2330435
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EU243_RS11895 (EU243_12085) | comGD | 2320383..2320820 (+) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| EU243_RS11900 (EU243_12090) | comGE | 2320804..2321118 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| EU243_RS11905 (EU243_12095) | comGF | 2321132..2321527 (+) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| EU243_RS11910 (EU243_12100) | comGG | 2321528..2321905 (+) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EU243_RS11915 (EU243_12105) | - | 2321962..2322141 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| EU243_RS11920 (EU243_12110) | - | 2322181..2322510 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| EU243_RS11925 (EU243_12115) | tapA | 2322769..2323440 (+) | 672 | WP_046559874.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EU243_RS11930 (EU243_12120) | sipW | 2323412..2323996 (+) | 585 | WP_046559873.1 | signal peptidase I SipW | - |
| EU243_RS11935 (EU243_12125) | tasA | 2324060..2324845 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| EU243_RS11940 (EU243_12130) | sinR | 2324893..2325228 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EU243_RS11945 (EU243_12135) | sinI | 2325262..2325435 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| EU243_RS11950 (EU243_12140) | - | 2325612..2326406 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| EU243_RS11955 (EU243_12145) | - | 2326424..2328094 (-) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| EU243_RS11960 (EU243_12150) | gcvT | 2328517..2329617 (+) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=343009 EU243_RS11945 WP_003153105.1 2325262..2325435(-) (sinI) [Bacillus velezensis strain DTU001]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=343009 EU243_RS11945 WP_003153105.1 2325262..2325435(-) (sinI) [Bacillus velezensis strain DTU001]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |