Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   EU243_RS11900 Genome accession   NZ_CP035533
Coordinates   2320804..2321118 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain DTU001     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2315804..2326118
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EU243_RS11875 (EU243_12065) - 2316845..2317795 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  EU243_RS11880 (EU243_12070) comGA 2317987..2319056 (+) 1070 Protein_2297 competence type IV pilus ATPase ComGA -
  EU243_RS11885 (EU243_12075) comGB 2319043..2320080 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  EU243_RS11890 (EU243_12080) comGC 2320127..2320393 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  EU243_RS11895 (EU243_12085) comGD 2320383..2320820 (+) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  EU243_RS11900 (EU243_12090) comGE 2320804..2321118 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  EU243_RS11905 (EU243_12095) comGF 2321132..2321527 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  EU243_RS11910 (EU243_12100) comGG 2321528..2321905 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  EU243_RS11915 (EU243_12105) - 2321962..2322141 (+) 180 WP_003153093.1 YqzE family protein -
  EU243_RS11920 (EU243_12110) - 2322181..2322510 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  EU243_RS11925 (EU243_12115) tapA 2322769..2323440 (+) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  EU243_RS11930 (EU243_12120) sipW 2323412..2323996 (+) 585 WP_046559873.1 signal peptidase I SipW -
  EU243_RS11935 (EU243_12125) tasA 2324060..2324845 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  EU243_RS11940 (EU243_12130) sinR 2324893..2325228 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EU243_RS11945 (EU243_12135) sinI 2325262..2325435 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=343006 EU243_RS11900 WP_015388003.1 2320804..2321118(+) (comGE) [Bacillus velezensis strain DTU001]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=343006 EU243_RS11900 WP_015388003.1 2320804..2321118(+) (comGE) [Bacillus velezensis strain DTU001]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment