Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETL58_RS16535 Genome accession   NZ_CP035413
Coordinates   3146668..3146808 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103629     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3141668..3151808
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETL58_RS16510 (ETL58_16510) yuxO 3142018..3142398 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETL58_RS16515 (ETL58_16515) comA 3142417..3143061 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETL58_RS16520 (ETL58_16520) comP 3143142..3145439 (-) 2298 WP_032730345.1 histidine kinase Regulator
  ETL58_RS16525 (ETL58_16525) comX 3145447..3145608 (-) 162 WP_003228803.1 competence pheromone ComX -
  ETL58_RS16530 (ETL58_16530) - 3145623..3146483 (-) 861 WP_029318489.1 polyprenyl synthetase family protein -
  ETL58_RS16535 (ETL58_16535) degQ 3146668..3146808 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETL58_RS16540 (ETL58_16540) - 3147030..3147155 (+) 126 WP_003228793.1 hypothetical protein -
  ETL58_RS16545 (ETL58_16545) - 3147269..3147637 (+) 369 WP_014477834.1 hypothetical protein -
  ETL58_RS16550 (ETL58_16550) pdeH 3147613..3148842 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ETL58_RS16555 (ETL58_16555) pncB 3148979..3150451 (-) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  ETL58_RS16560 (ETL58_16560) pncA 3150467..3151018 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  ETL58_RS16565 (ETL58_16565) yueI 3151115..3151513 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=340820 ETL58_RS16535 WP_003220708.1 3146668..3146808(-) (degQ) [Bacillus subtilis strain SRCM103629]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=340820 ETL58_RS16535 WP_003220708.1 3146668..3146808(-) (degQ) [Bacillus subtilis strain SRCM103629]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment