Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   F5K02_RS02030 Genome accession   NZ_CP044132
Coordinates   433421..433540 (+) Length   39 a.a.
NCBI ID   WP_064115825.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ZKY01     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 428421..438540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5K02_RS02015 (F5K02_02015) - 430036..430719 (+) 684 WP_007410267.1 response regulator transcription factor -
  F5K02_RS02020 (F5K02_02020) - 430706..432127 (+) 1422 WP_195182934.1 HAMP domain-containing sensor histidine kinase -
  F5K02_RS02025 (F5K02_02025) rapC 432289..433437 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  F5K02_RS02030 (F5K02_02030) phrC 433421..433540 (+) 120 WP_064115825.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  F5K02_RS02035 (F5K02_02035) - 433689..433784 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  F5K02_RS02040 (F5K02_02040) - 433879..435243 (-) 1365 WP_241457887.1 aspartate kinase -
  F5K02_RS02045 (F5K02_02045) ceuB 435657..436610 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  F5K02_RS02050 (F5K02_02050) - 436600..437547 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  F5K02_RS02055 (F5K02_02055) - 437541..438299 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4210.94 Da        Isoelectric Point: 8.0284

>NTDB_id=340744 F5K02_RS02030 WP_064115825.1 433421..433540(+) (phrC) [Bacillus amyloliquefaciens strain ZKY01]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=340744 F5K02_RS02030 WP_064115825.1 433421..433540(+) (phrC) [Bacillus amyloliquefaciens strain ZKY01]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment