Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ETK69_RS16565 Genome accession   NZ_CP035410
Coordinates   3268922..3269062 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM103616     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3263922..3274062
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK69_RS16540 (ETK69_16540) - 3264219..3264602 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ETK69_RS16545 (ETK69_16545) comA 3264624..3265268 (-) 645 WP_129093769.1 response regulator transcription factor Regulator
  ETK69_RS16550 (ETK69_16550) comP 3265349..3267652 (-) 2304 WP_070082286.1 histidine kinase Regulator
  ETK69_RS16555 (ETK69_16555) comX 3267672..3267851 (-) 180 WP_318010531.1 competence pheromone ComX -
  ETK69_RS16560 (ETK69_16560) comQ 3267805..3268791 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ETK69_RS16565 (ETK69_16565) degQ 3268922..3269062 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ETK69_RS16575 (ETK69_16575) - 3269527..3269868 (+) 342 WP_021495366.1 hypothetical protein -
  ETK69_RS16580 (ETK69_16580) - 3269875..3271098 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ETK69_RS16585 (ETK69_16585) - 3271228..3272694 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ETK69_RS16590 (ETK69_16590) - 3272712..3273263 (-) 552 WP_017419426.1 isochorismatase family cysteine hydrolase -
  ETK69_RS16595 (ETK69_16595) - 3273360..3273758 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=340662 ETK69_RS16565 WP_003152043.1 3268922..3269062(-) (degQ) [Bacillus velezensis strain SRCM103616]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=340662 ETK69_RS16565 WP_003152043.1 3268922..3269062(-) (degQ) [Bacillus velezensis strain SRCM103616]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment