Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ETK69_RS16565 | Genome accession | NZ_CP035410 |
| Coordinates | 3268922..3269062 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SRCM103616 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3263922..3274062
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETK69_RS16540 (ETK69_16540) | - | 3264219..3264602 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| ETK69_RS16545 (ETK69_16545) | comA | 3264624..3265268 (-) | 645 | WP_129093769.1 | response regulator transcription factor | Regulator |
| ETK69_RS16550 (ETK69_16550) | comP | 3265349..3267652 (-) | 2304 | WP_070082286.1 | histidine kinase | Regulator |
| ETK69_RS16555 (ETK69_16555) | comX | 3267672..3267851 (-) | 180 | WP_318010531.1 | competence pheromone ComX | - |
| ETK69_RS16560 (ETK69_16560) | comQ | 3267805..3268791 (-) | 987 | WP_269321599.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| ETK69_RS16565 (ETK69_16565) | degQ | 3268922..3269062 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ETK69_RS16575 (ETK69_16575) | - | 3269527..3269868 (+) | 342 | WP_021495366.1 | hypothetical protein | - |
| ETK69_RS16580 (ETK69_16580) | - | 3269875..3271098 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| ETK69_RS16585 (ETK69_16585) | - | 3271228..3272694 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| ETK69_RS16590 (ETK69_16590) | - | 3272712..3273263 (-) | 552 | WP_017419426.1 | isochorismatase family cysteine hydrolase | - |
| ETK69_RS16595 (ETK69_16595) | - | 3273360..3273758 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=340662 ETK69_RS16565 WP_003152043.1 3268922..3269062(-) (degQ) [Bacillus velezensis strain SRCM103616]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=340662 ETK69_RS16565 WP_003152043.1 3268922..3269062(-) (degQ) [Bacillus velezensis strain SRCM103616]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |