Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   ETK61_RS17430 Genome accession   NZ_CP035406
Coordinates   3198056..3198223 (-) Length   55 a.a.
NCBI ID   WP_100505762.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103612     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3193056..3203223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETK61_RS17400 (ETK61_17405) mrpE 3193451..3193927 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  ETK61_RS17405 (ETK61_17410) mrpF 3193927..3194211 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ETK61_RS17410 (ETK61_17415) mnhG 3194195..3194569 (+) 375 WP_041332992.1 monovalent cation/H(+) antiporter subunit G -
  ETK61_RS17415 (ETK61_17420) yuxO 3194608..3194988 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETK61_RS17420 (ETK61_17425) comA 3195007..3195651 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETK61_RS17425 (ETK61_17430) comP 3195732..3198041 (-) 2310 WP_129137873.1 two-component system sensor histidine kinase ComP Regulator
  ETK61_RS17430 (ETK61_17435) comX 3198056..3198223 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  ETK61_RS17435 (ETK61_17440) comQ 3198207..3199109 (-) 903 WP_129137874.1 polyprenyl synthetase family protein Regulator
  ETK61_RS17440 (ETK61_17445) degQ 3199294..3199434 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETK61_RS17445 (ETK61_17450) - 3199656..3199781 (+) 126 WP_003228793.1 hypothetical protein -
  ETK61_RS17450 (ETK61_17455) - 3199895..3200263 (+) 369 WP_014477834.1 hypothetical protein -
  ETK61_RS17455 (ETK61_17460) pdeH 3200239..3201468 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  ETK61_RS17460 (ETK61_17465) pncB 3201605..3203077 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6505.42 Da        Isoelectric Point: 4.3494

>NTDB_id=340584 ETK61_RS17430 WP_100505762.1 3198056..3198223(-) (comX) [Bacillus subtilis strain SRCM103612]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYLSGPITREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=340584 ETK61_RS17430 WP_100505762.1 3198056..3198223(-) (comX) [Bacillus subtilis strain SRCM103612]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACAGAAACAATAATTAAAGCTTATAATGATTATTATTTGTCTGGCCCAATAACCCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.453

96.364

0.891

Multiple sequence alignment