Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETA18_RS12435 Genome accession   NZ_CP035400
Coordinates   2416784..2416957 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103835     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2411784..2421957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA18_RS12420 (ETA18_12420) gcvT 2412584..2413672 (-) 1089 WP_128993147.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA18_RS12425 (ETA18_12425) hepAA 2414113..2415786 (+) 1674 WP_128993149.1 SNF2-related protein -
  ETA18_RS12430 (ETA18_12430) yqhG 2415807..2416601 (+) 795 WP_003230200.1 YqhG family protein -
  ETA18_RS12435 (ETA18_12435) sinI 2416784..2416957 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA18_RS12440 (ETA18_12440) sinR 2416991..2417326 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA18_RS12445 (ETA18_12445) tasA 2417419..2418204 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ETA18_RS12450 (ETA18_12450) sipW 2418268..2418840 (-) 573 WP_128993656.1 signal peptidase I SipW -
  ETA18_RS12455 (ETA18_12455) tapA 2418824..2419585 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  ETA18_RS12460 (ETA18_12460) yqzG 2419857..2420183 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA18_RS12465 (ETA18_12465) spoIITA 2420225..2420404 (-) 180 WP_014480252.1 YqzE family protein -
  ETA18_RS12470 (ETA18_12470) comGG 2420476..2420850 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  ETA18_RS12475 (ETA18_12475) comGF 2420851..2421234 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  ETA18_RS12480 (ETA18_12480) comGE 2421260..2421607 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=340096 ETA18_RS12435 WP_003230187.1 2416784..2416957(+) (sinI) [Bacillus subtilis strain SRCM103835]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340096 ETA18_RS12435 WP_003230187.1 2416784..2416957(+) (sinI) [Bacillus subtilis strain SRCM103835]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment