Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ETA18_RS12475 Genome accession   NZ_CP035400
Coordinates   2420851..2421234 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103835     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2415851..2426234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA18_RS12435 (ETA18_12435) sinI 2416784..2416957 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA18_RS12440 (ETA18_12440) sinR 2416991..2417326 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA18_RS12445 (ETA18_12445) tasA 2417419..2418204 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ETA18_RS12450 (ETA18_12450) sipW 2418268..2418840 (-) 573 WP_128993656.1 signal peptidase I SipW -
  ETA18_RS12455 (ETA18_12455) tapA 2418824..2419585 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  ETA18_RS12460 (ETA18_12460) yqzG 2419857..2420183 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA18_RS12465 (ETA18_12465) spoIITA 2420225..2420404 (-) 180 WP_014480252.1 YqzE family protein -
  ETA18_RS12470 (ETA18_12470) comGG 2420476..2420850 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  ETA18_RS12475 (ETA18_12475) comGF 2420851..2421234 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  ETA18_RS12480 (ETA18_12480) comGE 2421260..2421607 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ETA18_RS12485 (ETA18_12485) comGD 2421591..2422022 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  ETA18_RS12490 (ETA18_12490) comGC 2422012..2422308 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  ETA18_RS12495 (ETA18_12495) comGB 2422322..2423359 (-) 1038 WP_128993154.1 comG operon protein ComGB Machinery gene
  ETA18_RS12500 (ETA18_12500) comGA 2423346..2424416 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ETA18_RS12510 (ETA18_12510) corA 2424828..2425781 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=340099 ETA18_RS12475 WP_029317913.1 2420851..2421234(-) (comGF) [Bacillus subtilis strain SRCM103835]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=340099 ETA18_RS12475 WP_029317913.1 2420851..2421234(-) (comGF) [Bacillus subtilis strain SRCM103835]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGATATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment