Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ETA12_RS15950 | Genome accession | NZ_CP035399 |
| Coordinates | 3177681..3177821 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SRCM103788 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3172681..3182821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETA12_RS15925 (ETA12_15925) | - | 3172978..3173361 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| ETA12_RS15930 (ETA12_15930) | comA | 3173383..3174027 (-) | 645 | WP_129093769.1 | response regulator transcription factor | Regulator |
| ETA12_RS15935 (ETA12_15935) | comP | 3174108..3176411 (-) | 2304 | WP_070082286.1 | histidine kinase | Regulator |
| ETA12_RS15940 (ETA12_15940) | comX | 3176431..3176610 (-) | 180 | WP_318010531.1 | competence pheromone ComX | - |
| ETA12_RS15945 (ETA12_15945) | comQ | 3176564..3177550 (-) | 987 | WP_269321599.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| ETA12_RS15950 (ETA12_15950) | degQ | 3177681..3177821 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ETA12_RS15960 (ETA12_15960) | - | 3178286..3178627 (+) | 342 | WP_021495366.1 | hypothetical protein | - |
| ETA12_RS15965 (ETA12_15965) | - | 3178634..3179857 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| ETA12_RS15970 (ETA12_15970) | - | 3179987..3181453 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| ETA12_RS15975 (ETA12_15975) | - | 3181471..3182022 (-) | 552 | WP_017419426.1 | isochorismatase family cysteine hydrolase | - |
| ETA12_RS15980 (ETA12_15980) | - | 3182119..3182517 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=340042 ETA12_RS15950 WP_003152043.1 3177681..3177821(-) (degQ) [Bacillus velezensis strain SRCM103788]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=340042 ETA12_RS15950 WP_003152043.1 3177681..3177821(-) (degQ) [Bacillus velezensis strain SRCM103788]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |