Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ES965_RS12395 Genome accession   NZ_CP035391
Coordinates   2397392..2397766 (-) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis strain SRCM103689     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2392392..2402766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS12355 (ES965_12355) yqhG 2392723..2393517 (+) 795 WP_003230200.1 YqhG family protein -
  ES965_RS12360 (ES965_12360) sinI 2393700..2393873 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES965_RS12365 (ES965_12365) sinR 2393907..2394242 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES965_RS12370 (ES965_12370) tasA 2394335..2395120 (-) 786 WP_129092524.1 biofilm matrix protein TasA -
  ES965_RS12375 (ES965_12375) sipW 2395184..2395756 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ES965_RS12380 (ES965_12380) tapA 2395740..2396501 (-) 762 WP_129092525.1 amyloid fiber anchoring/assembly protein TapA -
  ES965_RS12385 (ES965_12385) yqzG 2396774..2397100 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  ES965_RS12390 (ES965_12390) spoIITA 2397142..2397321 (-) 180 WP_014480252.1 YqzE family protein -
  ES965_RS12395 (ES965_12395) comGG 2397392..2397766 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ES965_RS12400 (ES965_12400) comGF 2397767..2398150 (-) 384 WP_129092526.1 ComG operon protein ComGF Machinery gene
  ES965_RS12405 (ES965_12405) comGE 2398176..2398523 (-) 348 WP_123373078.1 ComG operon protein 5 Machinery gene
  ES965_RS12410 (ES965_12410) comGD 2398507..2398938 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  ES965_RS12415 (ES965_12415) comGC 2398928..2399224 (-) 297 WP_129092527.1 comG operon protein ComGC Machinery gene
  ES965_RS12420 (ES965_12420) comGB 2399238..2400275 (-) 1038 WP_129092528.1 comG operon protein ComGB Machinery gene
  ES965_RS12425 (ES965_12425) comGA 2400262..2401332 (-) 1071 WP_024573393.1 competence protein ComGA Machinery gene
  ES965_RS12430 (ES965_12430) - 2401545..2401742 (-) 198 WP_124058597.1 hypothetical protein -
  ES965_RS12435 (ES965_12435) corA 2401744..2402697 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=339624 ES965_RS12395 WP_032726157.1 2397392..2397766(-) (comGG) [Bacillus subtilis strain SRCM103689]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=339624 ES965_RS12395 WP_032726157.1 2397392..2397766(-) (comGG) [Bacillus subtilis strain SRCM103689]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96

Multiple sequence alignment