Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH38_RS09170 Genome accession   NZ_CP035242
Coordinates   1787625..1787774 (-) Length   49 a.a.
NCBI ID   WP_050095619.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901947     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1782625..1792774
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH38_RS09135 (EQH38_09620) trmB 1782868..1783503 (-) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  EQH38_RS09140 (EQH38_09625) ccrZ 1783500..1784294 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  EQH38_RS09145 (EQH38_09630) - 1784455..1785066 (-) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  EQH38_RS09150 (EQH38_09640) blpZ 1785217..1785450 (-) 234 WP_000276498.1 immunity protein BlpZ -
  EQH38_RS09155 (EQH38_09645) - 1785492..1786181 (-) 690 WP_000760527.1 CPBP family intramembrane glutamic endopeptidase -
  EQH38_RS09160 (EQH38_09650) - 1786233..1786616 (-) 384 WP_000877381.1 hypothetical protein -
  EQH38_RS09165 (EQH38_09660) - 1787402..1787521 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH38_RS09170 (EQH38_09665) cipB 1787625..1787774 (-) 150 WP_050095619.1 bacteriocin-like peptide BlpO Regulator
  EQH38_RS09175 (EQH38_09670) blpJ 1787843..1788112 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  EQH38_RS09180 (EQH38_09680) blpI 1788579..1788776 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  EQH38_RS10935 comA/nlmT 1789058..1789645 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQH38_RS09185 (EQH38_09685) comA/nlmT 1789572..1791215 (+) 1644 WP_078158894.1 peptide cleavage/export ABC transporter Regulator
  EQH38_RS09190 (EQH38_09690) - 1791226..1792587 (+) 1362 WP_054366144.1 bacteriocin secretion accessory protein -
  EQH38_RS09195 (EQH38_09695) blpC 1792644..1792772 (+) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5137.91 Da        Isoelectric Point: 3.9133

>NTDB_id=337158 EQH38_RS09170 WP_050095619.1 1787625..1787774(-) (cipB) [Streptococcus pneumoniae strain TVO_1901947]
MDTKMMSQFSVMDTEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=337158 EQH38_RS09170 WP_050095619.1 1787625..1787774(-) (cipB) [Streptococcus pneumoniae strain TVO_1901947]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment