Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EQY76_RS12600 Genome accession   NZ_CP035230
Coordinates   2372526..2372900 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SRCM103551     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2367526..2377900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQY76_RS12560 (EQY76_12560) yqhG 2367857..2368651 (+) 795 WP_003230200.1 YqhG family protein -
  EQY76_RS12565 (EQY76_12565) sinI 2368834..2369007 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQY76_RS12570 (EQY76_12570) sinR 2369041..2369376 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQY76_RS12575 (EQY76_12575) tasA 2369469..2370254 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQY76_RS12580 (EQY76_12580) sipW 2370318..2370890 (-) 573 WP_003230181.1 signal peptidase I SipW -
  EQY76_RS12585 (EQY76_12585) tapA 2370874..2371635 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  EQY76_RS12590 (EQY76_12590) yqzG 2371907..2372233 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQY76_RS12595 (EQY76_12595) spoIITA 2372275..2372454 (-) 180 WP_029726723.1 YqzE family protein -
  EQY76_RS12600 (EQY76_12600) comGG 2372526..2372900 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQY76_RS12605 (EQY76_12605) comGF 2372901..2373284 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  EQY76_RS12610 (EQY76_12610) comGE 2373310..2373657 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  EQY76_RS12615 (EQY76_12615) comGD 2373641..2374072 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  EQY76_RS12620 (EQY76_12620) comGC 2374062..2374358 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  EQY76_RS12625 (EQY76_12625) comGB 2374372..2375409 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  EQY76_RS12630 (EQY76_12630) comGA 2375396..2376466 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQY76_RS12635 (EQY76_12635) - 2376678..2376875 (-) 198 WP_014480259.1 CBS domain-containing protein -
  EQY76_RS12640 (EQY76_12640) corA 2376877..2377830 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=336380 EQY76_RS12600 WP_014480253.1 2372526..2372900(-) (comGG) [Bacillus subtilis strain SRCM103551]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=336380 EQY76_RS12600 WP_014480253.1 2372526..2372900(-) (comGG) [Bacillus subtilis strain SRCM103551]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment