Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQY76_RS12565 Genome accession   NZ_CP035230
Coordinates   2368834..2369007 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103551     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2363834..2374007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQY76_RS12550 (EQY76_12550) gcvT 2364633..2365721 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  EQY76_RS12555 (EQY76_12555) hepAA 2366163..2367836 (+) 1674 WP_003230203.1 SNF2-related protein -
  EQY76_RS12560 (EQY76_12560) yqhG 2367857..2368651 (+) 795 WP_003230200.1 YqhG family protein -
  EQY76_RS12565 (EQY76_12565) sinI 2368834..2369007 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQY76_RS12570 (EQY76_12570) sinR 2369041..2369376 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQY76_RS12575 (EQY76_12575) tasA 2369469..2370254 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQY76_RS12580 (EQY76_12580) sipW 2370318..2370890 (-) 573 WP_003230181.1 signal peptidase I SipW -
  EQY76_RS12585 (EQY76_12585) tapA 2370874..2371635 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  EQY76_RS12590 (EQY76_12590) yqzG 2371907..2372233 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQY76_RS12595 (EQY76_12595) spoIITA 2372275..2372454 (-) 180 WP_029726723.1 YqzE family protein -
  EQY76_RS12600 (EQY76_12600) comGG 2372526..2372900 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQY76_RS12605 (EQY76_12605) comGF 2372901..2373284 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  EQY76_RS12610 (EQY76_12610) comGE 2373310..2373657 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=336378 EQY76_RS12565 WP_003230187.1 2368834..2369007(+) (sinI) [Bacillus subtilis strain SRCM103551]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=336378 EQY76_RS12565 WP_003230187.1 2368834..2369007(+) (sinI) [Bacillus subtilis strain SRCM103551]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment