Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQW70_RS13600 Genome accession   NZ_CP035226
Coordinates   2577119..2577502 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain SRCM103517     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2572119..2582502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQW70_RS13560 (EQW70_13560) sinI 2573053..2573226 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQW70_RS13565 (EQW70_13565) sinR 2573260..2573595 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQW70_RS13570 (EQW70_13570) tasA 2573687..2574472 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQW70_RS13575 (EQW70_13575) sipW 2574537..2575109 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EQW70_RS13580 (EQW70_13580) tapA 2575093..2575854 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  EQW70_RS13585 (EQW70_13585) yqzG 2576125..2576451 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  EQW70_RS13590 (EQW70_13590) spoIITA 2576493..2576672 (-) 180 WP_014480252.1 YqzE family protein -
  EQW70_RS13595 (EQW70_13595) comGG 2576744..2577118 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  EQW70_RS13600 (EQW70_13600) comGF 2577119..2577502 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQW70_RS13605 (EQW70_13605) comGE 2577528..2577875 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  EQW70_RS13610 (EQW70_13610) comGD 2577859..2578290 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  EQW70_RS13615 (EQW70_13615) comGC 2578280..2578576 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQW70_RS13620 (EQW70_13620) comGB 2578590..2579627 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  EQW70_RS13625 (EQW70_13625) comGA 2579614..2580684 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQW70_RS22495 (EQW70_13630) - 2580912..2581043 (-) 132 WP_284690695.1 hypothetical protein -
  EQW70_RS13635 (EQW70_13635) corA 2581096..2582049 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=336222 EQW70_RS13600 WP_032726158.1 2577119..2577502(-) (comGF) [Bacillus subtilis strain SRCM103517]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=336222 EQW70_RS13600 WP_032726158.1 2577119..2577502(-) (comGF) [Bacillus subtilis strain SRCM103517]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment