Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EQW70_RS13560 Genome accession   NZ_CP035226
Coordinates   2573053..2573226 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103517     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2568053..2578226
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQW70_RS13540 (EQW70_13540) gcvT 2568851..2569939 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  EQW70_RS13545 (EQW70_13545) hepAA 2570381..2572054 (+) 1674 WP_038829735.1 SNF2-related protein -
  EQW70_RS13550 (EQW70_13550) yqhG 2572075..2572869 (+) 795 WP_032726154.1 YqhG family protein -
  EQW70_RS13560 (EQW70_13560) sinI 2573053..2573226 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQW70_RS13565 (EQW70_13565) sinR 2573260..2573595 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQW70_RS13570 (EQW70_13570) tasA 2573687..2574472 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQW70_RS13575 (EQW70_13575) sipW 2574537..2575109 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EQW70_RS13580 (EQW70_13580) tapA 2575093..2575854 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  EQW70_RS13585 (EQW70_13585) yqzG 2576125..2576451 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  EQW70_RS13590 (EQW70_13590) spoIITA 2576493..2576672 (-) 180 WP_014480252.1 YqzE family protein -
  EQW70_RS13595 (EQW70_13595) comGG 2576744..2577118 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  EQW70_RS13600 (EQW70_13600) comGF 2577119..2577502 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQW70_RS13605 (EQW70_13605) comGE 2577528..2577875 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=336219 EQW70_RS13560 WP_014477323.1 2573053..2573226(+) (sinI) [Bacillus subtilis strain SRCM103517]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=336219 EQW70_RS13560 WP_014477323.1 2573053..2573226(+) (sinI) [Bacillus subtilis strain SRCM103517]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment