Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EQJ08_RS12195 Genome accession   NZ_CP035167
Coordinates   2391323..2391496 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM104008     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2386323..2396496
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ08_RS12175 (EQJ08_12175) gcvT 2387121..2388209 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  EQJ08_RS12180 (EQJ08_12180) hepAA 2388651..2390324 (+) 1674 WP_038829735.1 SNF2-related protein -
  EQJ08_RS12185 (EQJ08_12185) yqhG 2390345..2391139 (+) 795 WP_032726154.1 YqhG family protein -
  EQJ08_RS12195 (EQJ08_12195) sinI 2391323..2391496 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQJ08_RS12200 (EQJ08_12200) sinR 2391530..2391865 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQJ08_RS12205 (EQJ08_12205) tasA 2391957..2392742 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQJ08_RS12210 (EQJ08_12210) sipW 2392807..2393379 (-) 573 WP_077671469.1 signal peptidase I SipW -
  EQJ08_RS12215 (EQJ08_12215) tapA 2393363..2394124 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  EQJ08_RS12220 (EQJ08_12220) yqzG 2394396..2394722 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQJ08_RS12225 (EQJ08_12225) spoIITA 2394764..2394943 (-) 180 WP_014480252.1 YqzE family protein -
  EQJ08_RS12230 (EQJ08_12230) comGG 2395015..2395389 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  EQJ08_RS12235 (EQJ08_12235) comGF 2395390..2395773 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQJ08_RS12240 (EQJ08_12240) comGE 2395799..2396146 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=335440 EQJ08_RS12195 WP_014477323.1 2391323..2391496(+) (sinI) [Bacillus subtilis strain SRCM104008]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=335440 EQJ08_RS12195 WP_014477323.1 2391323..2391496(+) (sinI) [Bacillus subtilis strain SRCM104008]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment