Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EQJ08_RS12230 Genome accession   NZ_CP035167
Coordinates   2395015..2395389 (-) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis strain SRCM104008     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2390015..2400389
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ08_RS12185 (EQJ08_12185) yqhG 2390345..2391139 (+) 795 WP_032726154.1 YqhG family protein -
  EQJ08_RS12195 (EQJ08_12195) sinI 2391323..2391496 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQJ08_RS12200 (EQJ08_12200) sinR 2391530..2391865 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQJ08_RS12205 (EQJ08_12205) tasA 2391957..2392742 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQJ08_RS12210 (EQJ08_12210) sipW 2392807..2393379 (-) 573 WP_077671469.1 signal peptidase I SipW -
  EQJ08_RS12215 (EQJ08_12215) tapA 2393363..2394124 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  EQJ08_RS12220 (EQJ08_12220) yqzG 2394396..2394722 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQJ08_RS12225 (EQJ08_12225) spoIITA 2394764..2394943 (-) 180 WP_014480252.1 YqzE family protein -
  EQJ08_RS12230 (EQJ08_12230) comGG 2395015..2395389 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  EQJ08_RS12235 (EQJ08_12235) comGF 2395390..2395773 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQJ08_RS12240 (EQJ08_12240) comGE 2395799..2396146 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  EQJ08_RS12245 (EQJ08_12245) comGD 2396130..2396561 (-) 432 WP_038829732.1 comG operon protein ComGD Machinery gene
  EQJ08_RS12250 (EQJ08_12250) comGC 2396551..2396847 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQJ08_RS12255 (EQJ08_12255) comGB 2396861..2397898 (-) 1038 WP_077671432.1 comG operon protein ComGB Machinery gene
  EQJ08_RS12260 (EQJ08_12260) comGA 2397885..2398955 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  EQJ08_RS12265 (EQJ08_12265) - 2399183..2399365 (-) 183 WP_033884706.1 hypothetical protein -
  EQJ08_RS12270 (EQJ08_12270) corA 2399367..2400320 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=335442 EQJ08_RS12230 WP_032726157.1 2395015..2395389(-) (comGG) [Bacillus subtilis strain SRCM104008]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=335442 EQJ08_RS12230 WP_032726157.1 2395015..2395389(-) (comGG) [Bacillus subtilis strain SRCM104008]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96

Multiple sequence alignment