Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQI27_RS12520 Genome accession   NZ_CP035163
Coordinates   2430301..2430684 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103923     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2425301..2435684
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI27_RS12480 (EQI27_12480) sinI 2426235..2426408 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI27_RS12485 (EQI27_12485) sinR 2426442..2426777 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI27_RS12490 (EQI27_12490) tasA 2426870..2427655 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  EQI27_RS12495 (EQI27_12495) sipW 2427719..2428291 (-) 573 WP_128492866.1 signal peptidase I SipW -
  EQI27_RS12500 (EQI27_12500) tapA 2428275..2429036 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  EQI27_RS12505 (EQI27_12505) yqzG 2429308..2429634 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI27_RS12510 (EQI27_12510) spoIITA 2429676..2429855 (-) 180 WP_003230176.1 YqzE family protein -
  EQI27_RS12515 (EQI27_12515) comGG 2429926..2430300 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  EQI27_RS12520 (EQI27_12520) comGF 2430301..2430684 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  EQI27_RS12525 (EQI27_12525) comGE 2430710..2431057 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  EQI27_RS12530 (EQI27_12530) comGD 2431041..2431472 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  EQI27_RS12535 (EQI27_12535) comGC 2431462..2431758 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQI27_RS12540 (EQI27_12540) comGB 2431772..2432809 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  EQI27_RS12545 (EQI27_12545) comGA 2432796..2433866 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQI27_RS12555 (EQI27_12555) corA 2434277..2435230 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=335122 EQI27_RS12520 WP_041850015.1 2430301..2430684(-) (comGF) [Bacillus subtilis strain SRCM103923]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=335122 EQI27_RS12520 WP_041850015.1 2430301..2430684(-) (comGF) [Bacillus subtilis strain SRCM103923]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment