Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGB   Type   Machinery gene
Locus tag   EQK21_RS03785 Genome accession   NZ_CP035110
Coordinates   752550..752756 (+) Length   68 a.a.
NCBI ID   WP_054644028.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain SRCM103465     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 747550..757756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQK21_RS03750 (EQK21_03750) - 748056..748535 (+) 480 WP_128530400.1 hypothetical protein -
  EQK21_RS03760 (EQK21_03760) - 748987..749364 (-) 378 WP_128530401.1 hypothetical protein -
  EQK21_RS03765 (EQK21_03765) - 749467..749967 (+) 501 WP_128530402.1 VanZ family protein -
  EQK21_RS03770 (EQK21_03770) - 750057..750788 (+) 732 WP_004270897.1 YebC/PmpR family DNA-binding transcriptional regulator -
  EQK21_RS03775 (EQK21_03775) comGA 750892..751767 (+) 876 WP_128530403.1 competence type IV pilus ATPase ComGA Machinery gene
  EQK21_RS03780 (EQK21_03780) comGB 751757..752506 (+) 750 WP_128530404.1 type II secretion system F family protein Machinery gene
  EQK21_RS03785 (EQK21_03785) comGB 752550..752756 (+) 207 WP_054644028.1 hypothetical protein Machinery gene
  EQK21_RS03790 (EQK21_03790) comGC 752753..753061 (+) 309 WP_004270901.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  EQK21_RS03795 (EQK21_03795) - 753042..753485 (+) 444 WP_089556486.1 type II secretion system protein -
  EQK21_RS10080 - 753550..753777 (+) 228 WP_164882251.1 hypothetical protein -
  EQK21_RS03800 (EQK21_03800) - 753725..754228 (+) 504 WP_164882291.1 competence type IV pilus minor pilin ComGF -
  EQK21_RS03805 (EQK21_03805) - 754206..754529 (+) 324 WP_039099486.1 hypothetical protein -
  EQK21_RS03810 (EQK21_03810) - 754645..755664 (+) 1020 WP_338323057.1 class I SAM-dependent methyltransferase -
  EQK21_RS03815 (EQK21_03815) - 755686..756879 (+) 1194 WP_128530409.1 acetate kinase -
  EQK21_RS03820 (EQK21_03820) - 756939..757391 (+) 453 WP_128530410.1 laaL -

Sequence


Protein


Download         Length: 68 a.a.        Molecular weight: 7811.51 Da        Isoelectric Point: 7.9996

>NTDB_id=334589 EQK21_RS03785 WP_054644028.1 752550..752756(+) (comGB) [Latilactobacillus curvatus strain SRCM103465]
MLAKGSPLQQMAKEVDLLAVIKYDELQRQLKQKVNWLQPLLFILIGIIIICTYLSILLPLYHTMEGIS

Nucleotide


Download         Length: 207 bp        

>NTDB_id=334589 EQK21_RS03785 WP_054644028.1 752550..752756(+) (comGB) [Latilactobacillus curvatus strain SRCM103465]
GTGCTCGCTAAGGGAAGTCCGTTACAACAGATGGCCAAGGAGGTCGATCTGCTTGCAGTCATTAAATACGATGAACTGCA
ACGGCAATTGAAACAGAAGGTGAATTGGCTACAACCGCTCTTGTTTATCCTAATTGGGATCATCATTATTTGTACCTATC
TCAGTATTTTATTACCGCTATATCATACAATGGAGGGAATTTCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGB Latilactobacillus sakei subsp. sakei 23K

67.647

100

0.676


Multiple sequence alignment